EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04552 alignment
(30 sequences with 164 aa)


O54393_MYXXA/344-503 KDFIQDKLRSAMWLIRSIHQRQRTIYKVTESIVKFQRDFLDKGIAYLKPLILRDVAEDIGMHESTVSRVTTSKYVHTPQGIFELKYFFNSSI.ARVSGED-TASEAVKHHIKQLVAQED.ARNPYSDQKIVELLRSQG.TEIARRTVAKYREVLGILPSSKRKR
Q98AS6_RHILO/303-463 QSFLNECLQNANWLIRSLDQRAKTILKVAAEIIRQQDAFFEHGVAHLRPLNLRTVADAINVHQSTVSRVTSNKYMLTPRGVFELKYFFTVAI.GSSEGGDAYSAEAVRHQIKAMVAVES.PNEVLSDDDIATRLKETG.IDIARRTVAKYREALNIPSSARRRR
O69778_RHIET/312-472 QSFLNECFQSASWLVRSLDQRATTILKVATEIVRHQDVFLEDGIAHLRPLNLKTIADAIDMHESTVSRVTSNKYILTPRGVFELKYFFTVAI.PSSQGGDAHSAEAVRHQIRALIAAET.LHDVLSDDGIVAKLKETG.VDIARRTVAKYREAMRIPSSTQRRR
RP541_RHIME/343-503 QAFLNECLQNANWLTRSLDQRARTIMKVASEIVRQQDAFLIHGVGHLRPLNLRIVADAIKMHESTVSRVTSNKYMLTPRGLFELKYFFTVSI.GSAENGDAHSAESVRHRIRTMINQES.ADAVLSDDDIVDVLKQAG.VDIARRTVAKYREAMSIPSSVQRRR
Q98GS5_RHILO/338-498 KDFLAECLQNANWLTRSLDQRAKTILKVASEIVRQQDAFLVHGVRQLKPLNLRTVADAIGMHESTVSRVTANKYMLTPRGVFELRYFFTASI.AASGGGDAHSSEAVRDRIKQLIDEEK.PVDVLSDDAIVDMLKESG.VDIARRTVAKYREGMNIPSSVQRRR
RP54_AZOCA/341-501 KTFLADCLQSASWLTRSLDQRARTILKVASEIVRQQDAFLVHGVRHLRPLNLRTVADAIGMHESTVSRVTSNKYISTPRGVLEMKFFFSSSI.ASSGGGEAHAAEAVRHRIKSLIEAES.ADDVLSDDTLVQKLKDDG.IDIARRTVAKYRESMNIPSSVQRRR
RP54_CAUCR/330-491 KTFVADCMASANWLVKSLDQRAKTILKVASEIVRQQDGFLAFGVEHLRPLNLKTVADAIGMHESTVSRVTSNKYIATPRGVFELKFFFTSAI.QSSEGGEAHSAASVRHKIKGLVDAEKcEADVHSDDRIVEILKAAG.VDIARRTVAKYREAMRIPSSVERRR
Q59085_AZOBR/359-519 KEYITERFQSANWLVKSLHQRATTILKVASEIIRQQDAFFIHGVSHLKPLILRDIAEAIGMHESTVSRVTTNKFMATPRGVFELKYFFTSAI.QGADGQAAHSAEAVRYRIKAMIDAEK.PDDVLSDDKIVEILRGEG.IDIARRTVAKYREAMRIPSSVQRRR
RP55_BRAJA/353-513 KSYFTDALQNATWLVRALDQRARTILKVATEIVRQQDGFFTHGVAHLRPLNLKAVADAIQMHESTVSRVTANKYMATNRGTFELKYFFTASI.ASADGGEAHSAEAVRHHIKQLIDSEA.PAAILSDDTIVERLRASG.IDIARRTVAKYREAMRIPSSVQRRR
Q9F1E7_ACEDI/298-457 RTYLNDTLTSANWLIRALQQRSMTILRVSTEILRRQEDFLQHGPQALQPLNLRTVAEALNIHESTVSRVTANKYVATPRGVLPLKFFFVAAM.TGNDGEI-RSNIAIQSVIRRMIQGER.PDAVLSDEAISLTLRRQG.IDIARRTVAKYREAMGFPNSLQRLQ
RP54_ACIGB/321-480 NQYLRNQMLEAKNFIKSVDERHKTLLKVASCIVQHQREFLEIGAEGMKPLVLRDVAEEVELHESTVSRVTTNKFLLTPRGLFELKYFFSSHV.GTTSGGE-ASSTAIRAKIKKLVADEN.PRKPLSDNTIANLLKEEG.IDVARRTVAKYRESLHIPSSSDRKV
RP54_AZOVI/341-500 NTFMRNQLQEARWFIKSLQSRNETLMKVSTQIVEHQRGFLDYGEEAMKPLVLHDIAEAVGMHESTISRVTTQKYMHTPRGIYELKYFFSSHV.STAEGGE-CSSTAIRAIIKKLIAAEN.PKKPLSDSKIAGLLEEQG.IQVARRTVAKYRESLSIAPSSERKR
Q9KP49_VIBCH/326-485 SNYIRTNLQEAKWLIKSLESRNETLLKVAKCIVEHQHDFFEYGEEAMKPMVLNDVAMAVEMHESTISRVTTQKYMHTPRGIFELKYFFSSHV.STDNGGE-CSSTAIRALIKKLVAAEN.PAKPLSDSKIATLLADQG.IQVARRTIAKYRESLGIAPSSQRKR
RP54_ECOLI/316-475 SQFIRSNLQDAKWLIKSLESRNDTLLRVSRCIVEQQQAFFEQGEEYMKPMVLADIAQAVEMHESTISRVTTQKYLHSPRGIFELKYFFSSHV.NTEGGGE-ASSTAIRALVKKLIAAEN.PAKPLSDSKLTSLLSEQG.IMVARRTVAKYRESLSIPPSNQRKQ
RP54_THIFE/315-474 HKYIQDQLNEARWFIKSLQSRQDTILKVARAIVERQKDFFANGPESMRPMVLRHIADAVEMHESTVSRVTNQKYMITPRGLYEFKYFFSSHV.GTDSGGS-ASATAIRALLIKMTQAED.AQHPLSDAEIARVLADQG.IQIARRTVAKYREAANVPPASQRRR
RP54_ALCEU/333-492 TAGLQQKLQEARWLIKNIQQRFDKILRVSQAIVERQKNFFSHGEIAMRPLVLREIADTLGLHESTISRVTTNKYMATPMGTFELKYFFGSHV.STETGGA-ASSTAIRALIKQLIGAED.PRNPLSDSRIAELLGEQG.FVVARRTVAKYREALKIPAVNLRKS
Q9PDH1_XYLFA/301-460 ASYLRNQLQEARWLLKGLEARGETLLKVVNSLIRHQTGFLEFGQHALRPLTIRELATELALHESTVSRAIAGKYVRTPRGTLPLRTFFASGI.STDSGGE-TSNSAIQAIIRRLIETEN.PRKPLSDAKLAELLKTSG.IPVARRTIAKYRDAMNISASHERVR
Q9K710_BACHD/282-443 AQYAKEKYHQMQWLVKSIQQRQQTLLKVTEAILRKQRAFFEEKEGALQPLTLREVAEEIGVHESTVSRATTNKYAQTPRGLLELKSFFVSSI.SSRFGEKGPSSDSVKKLVRKLVEEEN.KAKPLSDQKIAHLLKDQYnVEASRRVIAKYRDELGIPSSTKRKR
Q9F0Q3_ENTFA/280-441 QEYIKDKKNEFEWLERAVNQRGDTILRVGQEIVRRQEAFFLEADRPLKPMTLKEIADALSIHESTVSRAVNGKYLETTFGVFELRSFFSTSIlSSEEDGEDVSTTMVKKQLQKLIDQEV.KSKPLSDQKLVERLKDSG.MEISRRTVAKYREALGIPSSSKRKR
RP54_BACSU/274-434 VSYLSAKYQEWRWLSRALRQRKQTITRIINELITRQKDFFLKGRSAMKPLTLREVADCLSLHESTVSRAIKGKTIQTPYGLFEMKLFFSAKA.EASGDGD-ASNYAVKTHLENLINQED.KTKPLSDQKLVDLLYEQHgIQISRRTVAKYRDQMNIPSSAARKR
O69080_PLALI/335-494 REYIKRKVESAKWLIESIEQRHNTLKRVAQAIVDHQIEFLEKGPEFISPLKMQQIADIVKVHVTTVSRAVDDKWIQTPRGLFPLKRFFGGGT.TTAEGEE-VAWHIIRLKLKEIVDGEN.KDDPLSDDALVEELAKHG.FNLARRTVTKYRKALNIPSSRQRRS
O66858_AQUAE/244-398 QKELKEAFERYESIRKVLDIRRRNLRKVLEKIVERQKDFLT-GKGSLKPLTLREVSSEIGIHESTLSRIVNSKYVKTPVGTYSLRTFFVRES.AEGLTQG----ELMK-LIKEIVENED.KRKPYSDQEIANILKEKG.FKVARRTVAKYREMLGIPSSRERRI
RP54_RHOSH/269-429 DAWLARARSQARWLERAVERRQATLLRTAVCLVRHQADFLDQGPRALRPLSMEEVALELDLHPSTISRATATRLIETPRGLIPLRAFFSRSV.SSDGPEAPQSQDALMALVREIIARED.RTKPFSDDAIVKQAKLAG.AVLARRTVTKYRETLGIPSSYDRKR
RP54_RHOCA/263-421 RAER-RRRGRGPGAGEALERRRDTLLRTAAVLVARQSAFLDKGPAHLVPLTLEDVASELGLHASTISRAVSGRMIQTQTRALPLRAFFSRAV.STQGGGEAVSRDSLDFVQRTWAAK-I.RQNPLSDDAIVTLAERAG.LRIARRTVAKYRSTLGLASSYERRR
Q9RII3_RHOSH/270-426 TPAARAAWTQAQAVGRMIENRNATLLRVAREILARQEAALDEGPSALVALTMTEVAEALGIHESTVSRVVAGTCVDTPRGTWWLRRMFSGRL.AEGGPSA----AAIRAAIARLVAQED.PAAPLSDGALVEALAAED.MQLARRTVAKYREMLNIPPGHRRRR
RP54_HELPJ/253-408 SDYLKEKLKEAKDLIDALNLRKATIYKIGLMLLEYQYDFFK--GKELRPLKLLDLANEFNHSVSTISRAISNKYLACERGVFPIKHFFSIAL.DNSETSN----AVIKDYLLELIKNED.KKEPLSDAKILELIEEKFhLKMVRRTITKYRQLLNIASSSERKR
Q9PPN1_CAMJE/254-410 HDFLSHYIKEAKNLVDALAMRKATLYKIGLMIVEYQYDFFM--GKEIKPMTFKDLALDLERNASTISRAVANKYLSCERGLIPLRDFFAFAL.DEE--GE-TSNVGVKEFVANLVKNED.RNKPLSDSKILELIKEEFkVDIGRRTITKYRKHLNIASSTDRKK
O51406_BORBU/263-415 TSENPQKQKKAKWLIESLRYRDEILAKIGIAIYTLQKEFLRRGFKSLRPMNLSILSEKISVSKSTISRAIKNKYLKCEWGTILIKELFSS-V.GGAKTNE-FSKLSIKITVKKLLEA-N.KKM--SDKEISVILKSKG.ISISRRTVNKYRNELK---SEKGRT
Q9Z7D5_CHLPN/269-424 QKNLSQQILSAKWLIKNLRKREQTLLQVMETLLPKQEDFLLGKIPAPYPLGIKDLAEDLSFHESTIFRAIENKAVAAPIGIFPLKHLFPRGI.HQDSSHS--KENVLQ-WIRQWIATE-.-QTPLSDSVISDRITAKG.IPCARRTVAKYRAQLKILPANKRKK
Q9PJD0_CHLMU/264-419 KDHLSQQIRAAKQLLRNIKKREETLLAVLRVLIPYQEEFLLKKRSVPKAFSVKQLARELSLHETTICRAINNKTLATPIGLISMRSLFPQAV.GACPDQS--KATILH-WIHQWISTE-.-KNPLSDEAISQKIIAKG.IPCARRTVAKYRSQLNIPPAHQRKH