EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04549 alignment
(8 sequences with 299 aa)


O35294_RAT/8-295 R----SCCCGSAQLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTREQNFTSAKISVSDLLKGIASLTMDTHEAV..VGNYTCEVTELSREGKTVIELKNRPVSWFSTNEKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLALTLIVVVGA-ILFIPGEKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLAVVGMCLCIMAC-EPVHGPLLISGLGIIALAELLGLVYMKFV---ASNQRTIQ
CD47_HUMAN/8-300 LLLG-SACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVshTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGLVITVIVIVGA-ILFVPGEYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAAC-IPMHGPLLISGLSILALAQLLGLVYMKFV---ASNQKTIQ
Q9GKE8_PIG/8-298 VLLG-SAYCGSAQLIFNITKSVEFTVCNTTVTIPCFVNNMEAKNISELYVKWKFKGKDIFIFDGAQHISKPSEAFPSSKISPSELLHGIASLKMDKRDAV..IGNYTCEVTELSREGETIIELKRRFVSWFSPNENILIVIFPILAILLFWGQFGILTLKYKSSYTKEKTIFLLVAGLMLTIIVIVGA-ILFIPGEYSTKNACGLGLIVIPTAILILLQYCVFMMALGMSSFTIAILILQVLGHVLSVVGLSLCVSEC-TPVHGPLLISGLGIIALAELLGLVYMKCV---ASDHKTIQ
Q9D9W5_MOUSE/8-270 LLLG-SFHCGLAQLTFKNINSVKASNCSRIVLIPCYVSNIEAQDINELFLKWKFGQDIIFVFDGHANKSTT-YTFPSAQIFPSEFLKGNASLTLAKNEAR..AGNYTCEVTELSREGKHTVELKYSDGSWFTLSENIPIIIFPFLTVLLFWAQFGILMQKYKSNPVNRKILILSTSGLLFTIIVTVGA-ALYIP-------AIGRTL-----------------------QAVIMFTIAQGLGAVLTLAGLYLTASDC-VPKYGLLLISGLAIITLVELFGLIYMKWLDPMIGFHKTQK
VA38_VARV/2-277 LRVRILLIYLCTFVVITSTKTIEYTACNDTIIIPCTIDN------PTKYIRWKLDNHNILTYNKTSKTIILSKWHTSAKLH--SLSDNDVSLIIKYKDIL..PGTYTCED---NTGIKSTVKLVQRHTNWFNDHHTMLMFIFTGITLFLLFLEIAYTSISV---VFSTNLGILQVFGCIIAMIELCGAF-LFYPSMFTLRHIIGLLMMTLPSIFLIITKVFSFWLLCKLSCAVHLIIYYQLAGYILTVLGLGLSLKEC---VDGTLLLSGLGTIMVSEHFSLLFLVCF---PSTQRDYY
Q9DHI5_YLDV/7-260 MYMYNYIIICLFKLSLSTYIKVNYTTCNSSIYIVCS-SNLPYNSI----IEWKFNNKVIL--------------------------NNNNTLKFNFNNNL..SGNYTCKALNLFNK----IELQL-VINWITSEEKTVILYLLVTQLVVLW--ITILTLSLKINKFK-KVINLYATLIWVTILCLFIQYILRLNKKYSFIDIYGIMLISVLLFSSIGVNVLTLLKIKK-NKYLIVIIILKTVASILFFLVYLLILFYCYKNIFGLFLIYNLLIINIFELSYLVCLLII---PIELRIKY
Q9Q8H3_9POXV/1-267 MIGLLFFVYVVPLAAENEVTVTPYTVCNKTVTLECNLDALIYKDINSVHVKWLFDTM----YDTISNKT------------------NGSSITFDFANNL..TGNYTCEAYSEFNSVKHVIALTF-VHQWFSREEIQFILSLLTIYIILLW--GNVCTITFKINNVS-KLIHVYSIALWMTLIMFVGQYMIGIDTDMLYVKVNGIILIQLSIFSSIFLQRILHKKLIP-SYLLNIVLGLKAVSYTGSTVVIALSFIGCYNKAYGYTYMYKLLFADILELISLIALYTL---PLGTQATY
Q9Q8V0_9POXV/10-276 AHVGLLLVVFVHLTVGNKVTVMPYTVCNTTITLECNLDELIYKDINSIHVKWLF-----YTMDDTISNIT-----------------NGSFIKFDFAKNL..SGNYTCEAYSDLNSVKNVIALNL-VHQWFSREELQFILSLLTIYIILLW--CNVYTITSKTSNIS-KLIHVYSIALWMTIIMFVGQYMIGINTDMIYVKINGIILIQLSIISSVFLQRILHKTIIP-SYLLNIVMGLKVLSFTGSTIVIALSFVGCYNKAYGYTYVYKLLFADVLELISLITLYVL---PFGTQTTY