EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04545 alignment
(162 sequences with 54 aa)


Q9ZTL1_CYACA/507-560 ALSQLDFREREVIRMRFGLDDGRTKSLGEVGSLFCVTRERVRQIETRALRKLRD
Q39477_CYACA/543-596 ALSLLNPYEREVIRMRFGLDDGRMKSVDEVCAYYCVQTSRIRRIEARALRKLRH
Q9EZJ8_THEAQ/372-425 ALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKY
Q59302_CHLPS/489-542 VLKTLTDRERFVLIHRFGLLDGKPKTLEEVGSAFNVTRERIRQIEAKALRKMRH
RPOD_SYNY3/360-413 VLDTLSPRERDVLRLRYGLDDGRMKTLEEIGQIFNVTRERIRQIEAKALRKLRH
O08332_STAAU/303-356 VLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRH
P77842_CHLAU/331-384 ALDQLSERERRVLELRYGLVDGQPRTLEEVGKAFGVTRERVRQIEVKALRKLRH
Q39515_CYACA/524-577 VLHCLSTREREVIRMRFGLTDGRPRTLEEVGSRFNVTRERIRQIESKALKKLRT
O67464_AQUAE/510-563 VLSTLSEKEREILMYRYGLVDGTEYTLEQVGKMFNVTRERIRQIENKALRKLRH
O08348_XANCP/555-608 VLAGLTPREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRH
HRDB_STRCO/446-499 VLDTLSEREAGVVSMRFGLTDGQPKTLDEIGKVYGVTRERIRQIESKTMSKLRH
HRDA_STRCO/331-384 VLSTLGERERKVVQLRYGLADGRPRTLEEIGRLFGVTRERIRQIESKTLSKLRD
P77840_CHLAU/278-331 VLMKLPERERKIIQLRYGLKDGRYRTLEEVGIEFGITRERIRQIEAVALRKLRH
P71106_CHLAU/281-334 ALNELPERERKILQLRYGLIDGQRRTLEEVGATFGITRERTRQIEAEALRRLRH
RPOD_BORBU/563-616 ILGTLPEREQEVVKMRFGLEDGYSLTLEEVGLHFNVTRERIRQIESKALRRLKN
RPOD_TREPA/545-598 ILSALPAREHEVLRMRFGLDGDYSQTLEEVGLYFDVTRERIRQIEAKALKRLRH
Q79VF3_CORGL/266-319 VLNTLEPREQDVIRLRYGLDDGVPRTLDQIGRRFGLSRERVRQIEREVMSKLRD
P77906_MYCTU/280-333 VLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERDVMSKLRH
Q9ZPL2_MAIZE/469-522 ALDTLTTREKQVVVLRFGLEDGRIRTLQEIGNIMGVSRERIRQIESGAFRKLRS
O22056_ARATH/504-557 VLDSLGTREKQVIRWRFGMEDGRMKTLQEIGEMMGVSRERVRQIESSAFRKLKN
Q9ZPL1_MAIZE/457-510 ALDSLSPRKKQVMRYRFGIEGGRARTLHDIGQLMGVSRERIRQIELGAFRKLRS
P94906_MICAE/311-364 LSDVLTEREKDVISLRYGLATSQPYTLEEVGGMFNLSRERVRQIQTKAMRKLRR
P73710_SYNY3/305-358 LAEVLTEREMEVICLRYGIASHQSYTLEEVGNMFNLSRERVRQIQSKAMRKLRR
P71149_CHLTE/233-286 SLSVLAPREADVIRSYFGIGMDNPLTLEEIGEKFKLTRERVRQIKEKAIRRLRQ
O22058_ARATH/505-558 LLEGLEPREKQVMVLRYGLQDYRPKSLEEIGKLFKVSKEWIRKIERRAMAKLRD
P77841_CHLAU/245-298 ALQQLSPRERSILRLRYGLDGEPMHTLEQIGQRLRLTRERVRQLEHEALRKLRD
HRDC_STRCO/274-327 AVGTLAPRESLILSLRYGLHDGRPRTLQQVAQHVGLTRERVRQLEKESLAHLRA
P77996_THETU/196-248 ILDSLPERERMILKMRFGF-GCNLKTLTEIGNIFGLTRERIRQIQNNTIKELRH
Q9ZSL6_ARATH/351-404 LLGSLTARESRVLGLYFGLNGETPMSFEEIGKSLKLSRERVRQINGIALKKLRN
Q9R6V8_SYNP7/256-309 LLDQLTEQQRQVIALRYGLEDGQVMTLASIGDRLQISRERVRQLEREALHTLRQ
Q9KHE8_ANASP/268-321 LMEQLTPQQKEVITLRFGLIDGQALTLARIGEILNISRERVRQIEREALTKLRK
P73666_SYNY3/254-307 LMAELTPQQREVLILRFGLNDGQPLTLASIGSMLSISRERVRQIEREALNKLRK
P96034_SYNSP/253-306 MLNDLTAQQQEVLTLRFGLRDGTPHTLAKIGEHLNISRERVRQIEHGSLAKLRK
Q9KHE5_ANASP/263-316 LLAELTPQQREVVALRFGLLDGNELSLAKVGERLNLSRERVRQLEHQALAHLRR
P96032_SYNSP/263-316 LIADLTPQQQEVIILRFGLNDGKELSLAKIGKRMNLSRERVRQLERQALNHLRR
Q55525_SYNY3/280-333 LLAELTPQQQAVLTMRFGLNDGQELSLAKIGQHLNISRERVRQLENQALAQLKR
Q55350_SYNSP/256-309 LMAELTPQQQAVIALRYGLDEGDSLSLAKVGERLNISRERVRKLERQAMDHLRR
RPSB_ANASP/268-321 LLAKLTPQQKEVLILRFGLAGGCELTLVQISQRMGISRERVRQVEKQALTLLRR
Q9R6V7_SYNP7/247-300 WLAHLTEREQQVLQLRFGLHDGEQHTLAEIGRRLNVSRERIRQVEARALQKLRV
Q9FD90_SYNEL/330-383 LLLELNHRERDVIRMRFGLRDGQIYSLAEIGQVLDLSRERVRQIEAKALQKLRH
RPSC_ANASP/348-401 LLADLTSRERDVILMRFGLADGHPYSLAEIGRALDLSRERVRQIESKALQKLRQ
P96035_SYNSP/330-383 LLTELTDREREVIQLRYGLGDGKTYSLAEIGRMLDVSRERVRQIEAKALQKLRQ
RPSC_SYNY3/336-389 ILLDLTPREQEVIALRFGFQDGVAHSLSEIGRILNLSRERVRQIEAKALQKLRH
Q9LD95_ARATH/479-532 LLNVLSPKERRIIKLRFGIDGGKQRSLSEIGEIYGLSKERVRQLESRALYRLKQ
O67437_AQUAE/245-298 LLSKLTDKERKVIELRFGLKGNEPKTLREIGEILGLSRERVRQLETRALRKLRS
HRDD_STRCO/268-321 LIGRLDPRTASIIKMRYGIDDGRERTLTEVGKEHGLTRERIRQIEKHALLELKK
Q9S4T1_LEGPN/275-328 LLDKLTENQQQVIARRFGLRGFEKATLEDVGKEIDLTRERVRQIQVEALKTLRT
O33503_PSETO/269-322 WLSELTDKQREVVIRRFGLRGHESSTLEDVGLEIGLTRERVRQIQVEGLKRLRE
O08372_ENTCL/278-331 WLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLRE
Q9KI19_COXBU/285-338 WLAQLDERHREVVILRFGLHENEKGTLEAVGKAVGLTRERVRQIQIDALQQLRH
Q9JP89_RHOGE/256-309 GLAELNEREREVLAGRFGLRDREPETLEELAARLGLTRERIRQIQQEALLKLKR
O52607_RALSO/310-363 WLARLSDKHRYVVERRFGLNHIEPATLEELAAEMGLTRERVRQIQQEALVKLKR
O83976_TREPA/246-299 ILRLLPARDAQVIRYRFGLGGYERRSLQEIGEIFQITKERVRQIEKKALLRIRS
Q9ZNX9_ARATH/452-505 VLDSLKPKESLVIRQRYGLDGKGDRTLGEIAGNLNISREMVRKHEVKALMKLKH
Q9KDC8_BACHD/172-225 YIHVLDDREKEVIVGRFGLDLEEERTQREIAKELGISRSYVSRIEKRALMKLFH
Q9ZDM4_RICPR/232-283 AMQILNDRELRILKDRK-LTDTPK-TLDILSSEYNISKERIRQIENTAFEKIKK
Q9LA67_RHIME/223-274 ALGELSEREMKIIRARR-LTEDGA-TLEELGVALGISKERVRQIETRALEKLRA
Q98FA7_RHILO/222-273 ALHALNARELRIIEERR-LNDEGA-TLEALGETLGISKERVRQIEARAMEKLKV
Q98FJ9_RHILO/230-281 ALAVLNERERRIFEARR-LAEEPL-TLEELSAEFDISRERVRQIEVRAFEKVQD
P94330_BRAJA/230-281 AMGVLNPRERRIFEARR-LADEPM-TLEDLAAEFGVSRERVRQIEVRAFEKVQS
P77830_BRAJA/230-281 ALANLNARERNIFTARW-LNEEST-TLEELAAEYGVSRERVRQIEERAFQKVKA
P95657_RHOSH/232-283 SMSVLNDREKDILVQRR-LTDDPV-TLEELSEGYGVSRERIRQIEVRAFEKLQA
O30806_RHOCA/233-284 AMDVLNERERDILMARR-LRDEPV-TLEELSSQYDVSRERIRQIEVRAFEKLQG
RP32_ZYMMO/235-286 AMDRLNDREKHILTERR-LSDNPK-TLEELSQVYGVSRERVRQIEVRAFDKLQK
RP32_CAUCR/230-281 AMVELTDRERHILTERR-LKDDPT-TLEELAAQYGVSRERVRQIEVRAFEKLQK
P94333_BRAJA/239-290 ALGGLAARERHVFEARR-LTECPV-TLDQLARELSISSERVRQIEIRAFAKVKR
Q53611_STIAU/224-275 ALQRLDPRERFIIEKRV-MSDSEM-TLSELGEHFGFSRERARQLEIRAKDKLKA
Q9LAQ0_COXBU/232-283 AMQSMDDRSRDILYQRW-LSEKKS-TLHELAAQYAVSAERIRQLEKNAMQKIRT
Q9KJX7_PSEPU/229-280 ALQGLDERSRDILYQRW-LAEEKA-TLHELADKYSVSAERIRQLEKNAMNKVKA
Q9CKM7_PASMU/226-277 ALEGLDERSLDIIKARW-LDENKA-TLQDLAAKYNISAERVRQLETNALKKLKS
Q9JVA9_NEIMA/229-281 ALAQLDDRSRRIVESRW-LQDDGGLTLHQLAAEYGVSAERIRQIEAKAMQKLRG
O82849_PSEHY/248-299 ALTQLDERSRAIVTRRW-LTEKPA-TLHELAAEYGISAERVRQIEAAALKKLRV
Q9ZIL3_MYXXA/212-263 FARTLEGKERFIFESRL--VSDEPLTLQDIGDKYGVSRERARQIEAALINRMRD
Q9Z5S6_ZYMMO/188-237 QIKTLPEREALVLQLYY----VEELNLKEIGEVLDLGTARISQIKKSAVDHLRQ
Q9L774_XANOR/186-235 AIGQLPEREQLVLSLYY----EQELNLKEIGAVLGVSESRVCQIHGQAVVRLRG
Q9KQD4_VIBCH/186-235 SIKSLPEREALVLSLYY----DEELNLKEIGEVLGVSESRVSQILSQSMQRLRT
FLIA_PSEAE/190-239 AIAKLPERERLVLALYY----DEELNLKEIGEVLGVSESRVSQLHSQCAARLRA
FLIA_YEREN/175-224 AIEALPEREKMVLTLYY----QEELNLKEIGAVLEVGESRVSQLHSQAIKRLRA
P77959_STRRP/222-271 AINTLPDREKTVVTLYY----YEGLTLAEIGNVLGVTESRVSQIHTKSVLQLRA
O84064_CHLTR/198-247 ALLALDEKERQVMALYY----YDDLVLKEIGKILGVSESRVSQIHSKALLKLRG
Q97H70_CLOAB/184-233 GIELLNEKDRMVLSLYY----YEGLTLKKIGNILNVSESRVCQLHTRAIMHLRK
Q9X004_THEMA/162-211 AIEKLSDKEKLVLSLRF----EKGLSLKEIARVLGVSESRVSQIISKSLLKIKK
Q9AES5_AERHY/181-230 VLTSLDKREQLLLSLYY----QQELNMKEIALVLGLTESRVCQLHKQCVLQLKQ
O67268_AQUAE/181-230 AVSKLPEREKLVIQLIF----YEELPAKEVAKILETSVSRVSQLKAKALERLRE
O25676_HELPY/199-248 ALNQMSEREQILIQLYY----FEELNLSEIKEILGITESRISQIIKEVIKKVRK
Q9ZIV9_9ACTO/288-337 LLRQLDDRERAIVRMRF----GQEMTQAQIGAELGVSQMHVSRLLSRIVRRLRT
Q9X7S2_STRCO/237-286 LMAELSERDRQIIHLRF----VEEATQAEIGERLGCSQMHVSRLIKRIITRLRE
Q9RIS5_STRCO/249-298 LIAELPSRDRKILSLRF----VAGMTQSEIGEELGISQMHVSRLLSRTLVRLRK
Q9ADM4_STRCO/264-313 LLAKLPPRERRIIMLRF----FANMTQSQIGEEVGISQMHVSRLLTRTLSQLRE
Q9K4K0_STRCO/222-271 GLRRLPERERAILYMRF----FEDMTQSRIADCLGISQMHVSRLISRSCARVRD
O86702_STRCO/207-256 RLAALPPRERAILYMRF----FNDMTQSRIAEQLGISQMHVSRLITRCCDRVRE
O52313_STRCO/207-256 CLEALPERERTILYLRF----FGGMTQSRIAQQLGISQMHVSRLLTGCFDRIRE
Q9K9T9_BACHD/178-231 ALHTLTDREKQIMELRFGLAGGEEKTQKDVADLLGISQSYISRLEKRIIKRLQK
RPSE_CLOAB/176-229 ALKKLNEREKRIVELRYGLTGVGEKTQKEVADMLGISQSYISRLEKRIIKRLKK
P70879_BACCO/199-248 AIRGLEERERLIVYLRY----YKDQTQSEAGERLGISQVQVSRLEKKILRVMKE
RPSF_BACLI/199-248 AIKDLDEREKLIVYLRY----YKDKTQSEVADRLGISQVQVSRLEKKILKQIKN
O32725_BACSH/197-246 VLTRLEPREQSIIYLRY----FSDCTQTEIANRLGISQVQVSRLEKKILAQLKS
Q9KFF0_BACHD/202-251 AFQVLDEREKQILLCTY----FEHLSQKETGHRLGISQMHVSRLQRRALKKLRD
Q99SI8_STAAN/203-252 ILPILSDREREIIQCTF----IEGLSQKETGERIGLSQMHVSRLQRTAIKKLQE
O85017_LISIN/202-251 VLPVLDEREQKILQYTF----IENRSQKETGELLDISQMHVSRIQRQAIKKLRE
O50232_BACLI/204-253 VLHVLSDREKQIIELTY----IQNKSQKETGDMLGISQMHVSRLQRKAVKKLRE
RPSB_BACAN/202-251 IFNVLNETEKSVIHYIF----EENLNQKDTGERLGISQMHVSRIKRQAISKLKQ
Q9X6P9_LEPIN/119-168 SVESLPQLEKNIIVLRF----LRKYTIKETADKLGISVRTVNRKTFATLTVLRK
O34843_BACSU/132-181 AIQKLTDKQKSVLTKVY----LHGATMQEIADSLGESRQNISNIHKKGLENIRK
Q9XCD8_MYCSM/141-190 ALQALPEEFRMAVYYAD----VEGFPYKEIAEIMETPIGTVMSRLHRGRRQLRD
O68520_MYXXA/129-178 AIDALPIDFRLVVILAD----LQEFSYKEIAEILECPVGTVMSRLFRGRKLLQK
Q9X1T4_THEMA/130-178 ALEKLSPEDRLLIKLRD----IDGLSYEEIASVLQKPVGTVKSRLHYARKRLG-
Q9RKI2_STRCO/138-187 ALGALPDKHRQVVQLVD----IDGLTYAEAAHLLDVPEGTVMSRLHRARKRIRA
Q9KIN1_PSEFL/20-69 AFDQLNTEQRALLLWVS----VEGLSYKDVADILDVPVGTVMSRLSRARQALRQ
Q9EXR8_BRAJA/106-155 KLARLPQEQRAVLLLVA----VEDLSYAAAADVLNVPVGTVMSRLSRARERLLQ
O86856_STRCO/135-183 ALGTLPADQRAAFVFVD----MQGYPVAEAARILDVPAGTIKSRCARGRARLL-
Q9WWP4_SYNP2/141-190 GLQSLSLEHRAVLVLHD----LKDLPQKEVAEILGIPPGTVKSRLHHARRSLRQ
P73744_SYNY3/126-175 GLATLSFEHRTVLVLHD----LEDLPQKTIAEVLNLPGGTIKSRLFYARRAMRE
Q9L1Z6_STRCO/151-200 GLDELPDAQRQVLVLRF----YADLPVRGIAEELGIPEGTVKSRLHTAVRALRA
O53798_MYCBO/119-168 ALAQLSAEHRAVIQRSY----YRGWSTAQIATDLGIAEGTVKSRLHYAVRALRL
Q9RCH4_AZOVI/135-184 TIQQLPEDLRTALTLRE----FDGLSYEDIASVMQCPVGTVRSRIFRAREAIDK
Q9KPA6_VIBCH/135-184 AIDALPDDLKTAMTLRE----LDGLSYEEIAEVMDCPVGTVRSRIFRAREAVEK
P73431_SYNY3/166-215 AIKDLPEAFRTTIILRE----IDGLAYEEIAEITGVSLGTVKSRIARARAKLQT
Q9KG50_BACHD/133-182 EIQALPPKYRMAVLLKY----MEDLSLKEISDILDLPVSTVKTRIHRGREALRK
SIGW_BACSU/133-182 KILKLPDKYRTVIVLKY----IDELSLIEIGEILNIPVGTVKTRIHRGREALRK
Q97E49_CLOAB/131-180 SIKKLTYDYRMVIMLRY----YEDLSYDEIASVLDMPIGTVKTKIYRAKNVLKK
Q98CJ9_RHILO/127-176 FIDALPEEHRTVIDLAY----YHGQSVTEIGEVLAIPVATVKTRMFYARKKLGE
Q9RXX5_DEIRA/171-219 ALMRLAPEYREAVVLRF----VEDLTYDEIARLQGVATGTAKSRVFRAKEQLA-
O83130_TREPA/103-152 ALDRLPEHLRVVLQLRE----YGDLNYKEIGRILGISEGNVKVRVFRARERLAK
Q983W6_RHILO/124-173 ATDSLPDIYRMVFVARV----IEGLSMEETADLLGVRPETVKTRLHRARALLRK
O68887_STRAT/108-157 AMKVLAPKQRSVVVLRH----WEQMSTEETAAALGMSAGTVKSTLHRALARLRE
CARQ_MYXXA/114-163 ALQQLHPDHREAVVLSK----VEGWSFEEIGALRGISPGAARLRAHRGYEKLRE
O05735_MYCAV/186-235 ALDSLPPEFRAAVVLCD----IEGLSYEEIGATLGVKLGTVRSRIHRGRQALRD
Q9K7J9_BACHD/126-175 AVFSLPLSYREVIYFYY----YEELSVKEVASFTGLNENTVKTRLRKGRLLLKN
O85900_SPHAR/123-172 ALESLPAHYLEVILLRD----FEELTIAEIAGRLHEPAGAIKSRLHRARALVRE
SIGV_BACSU/109-158 ALDELPYRYKTIIILRF----FEDLKLEEIAEITGENTNTVKTRLYRALKLMRI
Q9R393_PSESX/129-178 AIDCLPSNMQKVLEVSL----EMDGNYQETANSLGVPIGTVRSRLSRARVQLKQ
Q9L1U1_STRCO/136-185 ALDDLTPAHREVLVETY----FKGRTVNEAAQTLGIPSGTVRSRVFYALRSMKL
Q9S2A7_STRCO/130-179 CLDRLTALQRQSVTLAY----YDGYTYREVAERLSLPLGTVKTRMRDGLGRLRE
O53730_MYCTU/133-182 CLKALTDTQRQCIELAY----YGGLTYVEVSRRLAANLSTIKSRMRDALRSLRN
Q55192_SYNY3/129-178 ALETLPPNQRQVLELAY----YEGLSQSEITQKLAIPLGTVKTRSRQGLLKLKN
Q9RI52_STRCO/141-190 ALSRLPQAQRDVLCMAF----YEDLTQAQIAERTGVPLGTVKSHARRGLHRLRT
Q984A3_RHILO/162-211 ALDLLPRDQADILKMSF----YGEVTQSEIANAVGIPLGTVKSRVRLALGRLRQ
Q9AAF3_CAUCR/146-195 AMQTLNPDQSQAIEMAF----FQEQTHSQISEALGVPLGTVKARIRFGMMKLRA
Q9KPR4_VIBCH/138-187 FLDRLPEAQQQVIKAVY----LEEIPQQDVADMLDIPLGTVKSRLRLAVEKLRL
Q9K7Z1_BACHD/126-175 ALKQIPTEQREAIIRSY----FRGETHSEIATTMDKPLGSIKSLIRYGLNNLRK
Q9KBA2_BACHD/122-171 LLDHLNEQQKEAIQLKY----FHDLDYQTIANMTNVSVGTVKSRVFQGLKKLRE
Q9A7S1_CAUCR/130-179 ALKSLSRGERLCVSLCY----GADWSHGEAAEALNIPIGTVKSHVKRGLDKLRA
Q9KF66_BACHD/114-163 VLSELKPEETTLLVLRY----YHDFTILEIARFMNKPEGTIKAQLHRTLAKVRK
Q9KCF6_BACHD/118-167 MIQQLDDKYKIPIVLHY----FHDQTYQEIAQVLGITEGAVKTRMLRAKQQLKA
SIGY_BACSU/124-173 LFSKLDPKLRTPVLLRH----YYGYTYAEIGVMLQIKEGTVKSRVHKGLQQIRK
Q9HYV8_PSEAE/143-192 TLNGLSELQRSVLTLRE----RQGLELEEIRDLLDITLSNVRVLLHRARLKVFA
O07627_BACSU/113-162 ELLKLKDQHQSVLILRE----FQELSYEEIAEILGWSLSKVNTTLHRARLELKK
Q9X8Z1_STRCO/115-163 ALRQIPEAQRRAVVLHH----LCDLTVEQVAAEVGSPVGTVKAQLSRGRAALA-
P74595_SYNY3/202-251 ALAGLEERTRRIVEFVF----LHDFTHKEAAEMMGVSVITVSRRIKQGIGALKK
Q9A3F1_CAUCR/123-172 ALASLPQRQRMLVSDVK----LTGLSLAEAGARAGISEGAAKVALHRALKALAE
Q98L14_RHILO/130-179 AVRQLPDKQRDAVLLVY----GEGLSHAAAAEAMAISETTVSWHIHEAKKRLKT
Q98BR7_RHILO/124-173 ALQAIAPRQREAIILVY----YQEMSNIEAAATLEISVDALESLLSRGRRALQM
Q9L430_BORBR/119-168 AIDALPPRCREVFVLYR----FEGLAQAEIAARLGISRNMVEKHVIRAMGACRA
Q9I444_PSEAE/118-167 ALAELPPRRREAFVLHK----FDGLSQVEVAERMGISLSMVEKHIASALLHCKR
Q9I3Y1_PSEAE/188-237 AIATLPPRCQAVFVMHK----IHEVPQAQVADRLGISVKTVEKHLRLGLAACRE
Q9A9J9_CAUCR/124-173 AIAELPTQCRRVFTLRK----VYSLSPDEIAVRLGLSVSTVEKHLVKGLRYCSE
Q9I6Y3_PSEAE/117-166 ALRGLPERTRRIFLLNR----IHGRTYAEIAQAMQLSQSAVEKHMMRALDACKA
Q9I646_PSEAE/116-165 LLGTLSLKARSAFLYSR----LDGMPHAEIAERLGVSVPRVRQYLAQGLRQCYI
Q9I222_PSEAE/116-165 LLDGLSGQARAVFLMSQ----LEGLTYVQIGERLGLSLGRIHQLMKDALHCCYR
Q9I2W5_PSEAE/108-157 WLVHVNPIDREILVLRF----VAELEFQEIADIMHMGLSATKMRYKRALDRLRE
Q9AD34_STRCO/172-221 ALARLTPDQWECLRLRY----WDNLPFCEVGQRMDRSTGAAKILKDRALRSLSA