EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04539 alignment
(81 sequences with 83 aa)


FLIA_ECOLI/90-172 PRSVRRNAREVAQAIGQLEQELGRNATETEVAERLGIDIADYRQMLLDTNNSQLFSYDEWREEHGDSIELVTDDHQRENPLQQ
Q9L7Q0_PROMI/90-172 PRSVRRNAREVTQSIHQLEQDLGRPPSEQEVADHLQIELAEYRQILLDTNNSQLFSYDEWHEIYGESCEPSQDEDHDDNPLQM
O52258_PSEPU/94-174 PRSVHRNTRMVSDAMRAVEARTGRDAKDHEVAAELQLSLDDYYGILNDTLGSRLFSFDDLLQ-DGEHEGLHEDG-ASGHVEPA
Q9L774_XANOR/94-174 PRSVHRRARDAAAAVRKIEQNTGRAAAAAEVAAAMEMPLPDYLRLMEDAARGQVLSLESRIEDHGELDT-TAKG-GPNPQQMM
Q9KQD4_VIBCH/93-174 PRSVHKHNREISQAIAVLEGELNRDPTDAEVAKFLNMSLEQYHSVLMDINCSRIVGIEDLGVSDDAISPFEEGE-DNSPFHGV
Q59823_STRAU/122-202 PRSVRQKARAVERAYATLEAQLRRTPTEGEVAGEMGIGVEELHTVFSQLSLANVVALEELLHVGGEGGD-RLSL-MDTLEDHA
P77959_STRRP/122-203 PRSVRQKARNVERAYATLEAQFRRTPSEAEVASEMGIALEELHAVFSQLSLANVVALEELLHVGGEGGDRLSLM-DTLEDTAA
Q9AYR7_PHYPA/414-496 PIHLYEVISRINKAKRMLVQEHGREARNEEVAELVGLTVEKLKSVVKSAKAPGSMERPIGKDGDTTLGELVADTDVDSPEDAI
O52921_CAMJE/459-541 PIHMIETINQINKIIREHLQKDGKEPDVSVIAKEVGLSVDKVKQVIKITKEPISLEAPIGNEDDGKFGDFVEDRNSLSPMDHI
O32637_HELPY/524-606 PIHMIDTINRINKVMRKHIQETGKEPDLEVVAEEVGLSLDKVKNVIKVTKEPISLETPVGNDDDGKFGDFVEDKNIVSSIDHI
RPOD_CHLTR/395-477 PVHMIETINKVLRGAKKLMMETGKEPTPEELGEELGFTPDRVREIYKIAQHPISLQAEVGDGGESSFGDFLEDTAVESPAEAT
RPOD_CLOAB/219-301 PVHMVETINKLIRVSRQLLQELGREPQPEEIAKIMDMPVDKVREIMKIAQEPVSLETPIGEEEDSHLGDFIPDDEAPAPADAA
O08332_STAAU/209-291 PVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMDLPAEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQEAQSPSDHA
RPOD_STRPN/209-291 PVHMVETINKLVREQRNLLQELGQDPTPEQIAERMDMTPDKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDEVIENPVDYT
RPOD_MYXXA/548-630 PVHMIETINKLIRTSRYLVQEIGREPTPEEIAEKMELPLDKVRKVLKIAKEPISLETPIGEEEDSHLGDFIEDKSLVSPADAV
RPOD_RHOCA/514-596 PVHMIETINKLVRTGRQMLHEIGREPTPEELAEKLQMPLEKVRKVMKIAKEPISLETPIGDEEDSQLGDFIEDKNAILPLDSA
Q9KH26_COXBU/248-330 PVHMIETINKLNRISRQILQETGIEATPEELGRRMDMPEEKVRKVLKIAKEPISMETPIGEDEDSNLGDFIEDINMESPVDFA
O08348_XANCP/461-543 PVHMIETINKLNRISRQMLQQFGREPTPEELAKEMDMPEDKIRKVMKIAKEPISMETPIGDDEDSHLGDFIEDTNVESPIDNT
Q9JTK6_NEIMA/477-559 PVHMIETINKMNRISRQHLQETGEEPDSAKLAELMQMPEDKIRKIMKIAKEPISMETPIGDDDDSHLGDFIEDANNVAPADAA
O85679_MICEC/24-106 PVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAV
HRDB_STRCO/352-434 PVHMVEVINKLARVQRQMLQDLGREPTPEELAKELDMTPEKVIEVQKYGREPISLHTPLGEDGDSEFGDLIEDSEAVVPADAV
O67464_AQUAE/416-498 PVHMIETINKIIKASKKLFQENGREPTPEEIAEYLDIPVEKVKKVMKFSQEPISLETPIGDDDDTFLKDFIEDKSIPNPEEQV
P77820_BORAF/305-387 PVHMIEQINRLNRETRYLVQVLGKDPTDEELSDRLGWELKKVKTVKSVSREPVSLETPIGEEEDSVLSDFIEDKAIKNPANHT
RPOD_TREPA/451-533 PVHMIEQINKVTRESRQLLQKFGREPSDEEIAQQLCWTVEKVKQVKSVAREPISLETPIGEEEDSSLGDFVPDADVENPSRVT
RPOD_THEMA/233-315 PVHMVETINKLNRLRREYYQKHGEEPSIEELAKMMGKPPEKIKEILEAAKETISLESPIGEDEDSSIEDFVADDSIASPKKEA
HRDA_STRCO/237-319 PVHVVELINRVVRVQRRMLQERGCEPTPQEVAAHLDLAPERVGEVLRLAQEPVSLHAPVGEEDDVALGDLIEDGDAASPVESA
Q79VF3_CORGL/172-254 PVHLVEQVNKLSRIKRELYQHLGREATNEELAEESGIEESKIEMLLRQSRDPVSLDMPVGADEEAPLGDFIEDSEATDAESAV
P77906_MYCTU/186-268 PVHLVEQVNKLARIKREMHQHLGREATDEELAAESGIPIDKINDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAV
HRDC_STRCO/180-262 PVHVVEQLQKLAKVERKLRAGLDREPTTEEVAAESGIDVDKVVWLRRVGRDAVSLDTPVDETGDTVVGDLIPDTEVLRAPEVA
P77842_CHLAU/237-319 PVHLGETLNRIQSARRQLTQSLGREPTDTELANHLGMSEEKLATVRRTAQDPVSLATPVGEEANSTLADFIPDPHALDADDAA
HRDD_STRCO/174-256 PVHLVEELGRIRRVQREFNREHGREPEPAEIAAELGSTPERVTDVLDWARDPVSLNMSVDDEGETQFGDLLEDTSAVSPEQSV
P77840_CHLAU/184-266 PVHMGEAISQVKRTSHRLQQTMQRDATPEEIADAMGISAGKVRRTLEASMHPLSLEMPVGQEGEGRMGDFIEDDRISTPAEAP
P71106_CHLAU/187-269 PVHLSESIVHLRRAIYRLEQELEREPTAEELAHALNMSVRKVKRLIRASTQPISLEQPLNNEQEGRVSETLADETVASPMEIA
Q55525_SYNY3/187-268 PIHITEKLNKIKKTQRELSQQLGRSATPAEVAKALEIDPSQIREYLSLSRQPISLDVRVGDNQDTELSELLEDE-GVSPDAYI
P96032_SYNSP/170-251 PIHITEKLNKIKKTQRQLAQDLGRAATIAEIAEALELEPAQIREYFRVSRHPISLDVRVGDNQDTELMDLLEDS-GESPDNNV
Q9KHE5_ANASP/170-251 PIHITEKLNKIKKVQRELAQTLGRSPSPAEIAKELELEPAQIREYLNMARQPVSLDVKVGDNQDTELQEMLEDD-GPSPEYYT
Q55350_SYNSP/163-244 PIHITEKLNKLKKTQRELSQQLGRSATASELAEVLELPLEQVREYIQMNRQPVSLDVKVGDSQDTELQELLEDE-QSSPSDYV
P96034_SYNSP/161-241 PIHITEKLNKIKKAQRQLAQANGRSASIPELADELGLTTKQVRDYLEKSRQPLSLDLRVGDNNDTELIE-LEDD-GELPDDYA
P73666_SYNY3/161-242 PIHITEKLNKIKKAQRQLSQEKGRAASIAELAEHLELTPKQVREYLERSRHPLSLDLRVGDNQDTELGDLLEDD-GPLPEDFA
Q9KHE8_ANASP/175-256 PIHITEKLNKIKKAQRQLSQRLGRAPTAGELANELELTPKQVREYLEKARLPLSLDLRLGDNYDTELGEMLEDP-GASPEDFV
Q9R6V8_SYNP7/163-244 PIHITEKLNKIKKMQRQLSQQL-STATLPELAAALDLTPAQVRDYLEKARHPLSLDLRVGDNQDTELGDLLETDMQRRRKEFT
RPSB_ANASP/175-256 PIHMADKLNKIKCVQRELSQKLGYIAGVTEIAQALNLEPSQIREYLQLVRQPVSLDMRIGFEQDTQLQDLLKDD-GMSPERYA
P73710_SYNY3/210-292 PIHVVEKLNKIKKAQRSLKQELKRNPNEGELAAALDITPAQLRQLLQLRRQSLSLNHRVGKGEDTELVDLLEDQQLQLPEDLM
Q9KHE4_ANASP/230-312 PIHIVEKLNKLKKAQRELKQKFSRNPSEAEMAEALEISVPQLRQLQQLRRQALSLNHRVGKEEDTELMDLLEDEDNLSPEAKM
P96035_SYNSP/237-318 PVHVTEKLNKIKKAQRQISQTQGCTPSLDDVAQALEMTPEQVREVLQKVPRSVSLEIRVGKDRDTELGDLLETQ-DASPEENL
RPSC_SYNY3/243-324 PVHITEKLNKIKRAQRKISQEKGHTPKIDEVAEELGMTPEQVREVLTQVPRSVSLELKVGQDKDTELMDLLETD-TQSPEDEL
RPSC_ANASP/255-336 PVHITEKLNKIKKAQRKIAQEKGRTPTLEDLAIELDMTPTQVREVLLRVPRSVSLETKVGKDKDTELGELLETD-GVTPEEML
Q9FD90_SYNEL/237-318 PVHVTEKLTRIKKAQRKIAQTKGRTANLEEIAQELEMTPDQVREVLLRVPKSISLETRVGKEKDTELGDLLETT-DFTPEERL
O30967_NOSPU/172-254 PIHINEKLNKIKRVQRELSQTLGRIPTSTEIANALSLKPSQIREFLLLATRTISLDIRVSSAKDLRLQDLIEDYKYSSNSYIT
Q9S4T1_LEGPN/181-263 PIHVVKELNVYLRAARQLTQKLDHEPSPEEIAEMVDKPLEDVQKLLGLNDKVASVDTPIGFDETKSLLDTIADENSLNPAELL
O33503_PSETO/175-257 PIHVVKELNVYLRAARELTQKLDHEPSPEEIANLLEKPVGEVKRMLGLNERVSSVDVSLGPDSDKTLLDTLTDDRPTDPCELL
O32416_VIBCH/169-251 PIHVVKELNIYLRTARELSQRLDHEPTPEEIALELDRPVDDVTKMLRLNERISSVDTPIGGDGDKALLDILPDSHNADPEFST
Q9F8R5_ECOLI/168-250 PIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILADEKENGPEDTT
Q9KI19_COXBU/191-273 PIHVIKELNVYLRTAKKLTQEVDHEATPEDVAHLIDKPVQEIRRIMDLAPSATSIDVPISEDGQKSLVDTLADDNNIDPARLI
Q9ZTL1_CYACA/409-489 PVHVNEMIKEIRRCSYELMNILGREPTKLEIAMKVGMPEEKVIFLLQRAQTALSLEMPLRGS-DSSLESRTLGD-VVSSTASP
P77841_CHLAU/151-233 PVHLGERLSRLSRLRQELSQQLDREPTLEELAAGCRPERRAGRTAEQAGLAPTSLDEPHTEDGGGALAEILTDPLQPTPFDEV
P71149_CHLTE/140-221 PLNRVGTLNKISKAYSQLEQEYERDPNTKELADLLDMDSQDVADTLKIAGRHVSVDAPFAQGDDNRLLDVLQND-GHMPDYTL
Q9ZPL0_MAIZE/379-460 PESVYALLRKVGKARMECIMDG-EQPTNEVVARRAGITIEKLAKLRAKTRKVRSMQDRVWSDDGVTYQEITEDPNIEGPEVSV
Q9LD95_ARATH/385-467 PENVYMLLGKVSEARKTCVQEGNYRPSKEELAGHVGVSTEKLDKLLYNTRTPLSMQQPIWSDQDTTFQEITPDSGIETPTMSV
Q9ZPL1_MAIZE/364-445 PAHMAEASSRVKECCRRLGRELKRLPSNEEIAVDTGMTIRRVEAAMSLPKYSVSFTSKVGCT-DVTYQEIMPDTSAETAEETL
Q9ZPL2_MAIZE/376-457 PAHMVEASYRVKECTKRLRRKLRRRPTNEEIAVDTGIPIKRVEAAVNLPKYSVSLDSKIGST-DMTYQEVTADPSAETAEEML
O22056_ARATH/410-492 PFHMVEATYRVKEARKQLYSETGKHPKNEEIAEATGLSMKRLMAVLLSPKPPRSLDQKIGMNQNLKPSEVIADPEAVTSEDIL
Q9ZSL6_ARATH/257-339 PGSMWELTAKVAEASNVLTRKLRRQPSCEEIAEHLNLNVSAVRLAVERSRSPVSLDRVASQNGRMTLQEIVRGPDETRPEEMV
Q9ZIV9_9ACTO/193-274 PRRLQELRVELAKAKEALSADLDRDPTVAELAARLDLSEEEIIEGLVAANGYSAGSLDTPSA-DSESGNEQRAYADLLGEDDP
Q55358_STRSE/106-185 PRRLQELRVDLAKAKESLAGDLDRDPTVRELAQDLGIEESEVTEGIVASNGYTAGSLDMPTD-TAEAGP-GQHS-GRTFADVL
P96891_MYCBO/117-197 PRRLKELHLRLGTATADLSQRLGRAPSASELAAELGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARA-ITDT-LGDVDAGL
Q9RIT0_STRCO/215-294 PRRLQELRLALTTATAELSQLHGRSPTVHELAEKLSISEEEVLEGLESANAYSTLSLDVPDT-DDESPA-VADT-LGAEDEAL
Q9RIS5_STRCO/157-237 PRRLQELRLDLAKAGDELAQRLDRAPTVSELAEHLGLSKDEVVEGMAASNAYTASSLDAQPEEDDAEGA-LADR-IGYEDHGL
Q9RIS8_STRCO/118-198 PRRLQEARVQLARATEELRSRLGRTPTTAELSELMSLPEDEVVEARLAANGYNSASLDAAIN-GSEDGESALAD-FIGADDAA
RPOF_STRCO/141-222 PRRLHELWVQVNSATEDLTTAFGRSPTTAEIAERLRITEEEVLSCIEAGRSYHATSLEAAQEGDGLPGL-LDRLGYEDPALDG
P95844_STAAU/109-191 PRRIKEIGPRIKKVSDELTAELERSPSISEIADRLEVSEEEVLEAMEMGQSYNALSVDHSIEADKDGSTVTLLDIMGQQDDHY
O50232_BACLI/110-191 PRRIKELGPRIKMAVDHLTNETQRSPKVDEIAEFLDVTEEEVLETMEMGKSYQALSVDHSIEADADGSTVTILD-IVGSQEEG
Q9KFF0_BACHD/108-189 PRRIKELGPKIKKAADELASELQRSPRVEEIADFLGVSEEEVLETMEMGKSYQALSVDRSLEADPEGGEVTLLD-LVGQEDGG
RPSB_BACAN/108-189 PRRIKDLGGKIKLAIEELTDHLQRSPKIIEIADHLGLSEEEVLEIMDAKNNYRVSSLDDVVE-NASDGSSVARIESVGEVEQG
Q9KA59_BACHD/102-182 PRSMREKIKKIEAATEKLEQKLGRNVSVEEVAKEVGISENEVSQTMTESLVANLLSMDEKTN-DSDREETYTAT-IIDKQSLS
Q9ZNX9_ARATH/359-440 PFGLESVRVEIYKAKTELWFEMGRPPTEDEVVERLKITPERYREVLRAAKPVLSLNSKHSVTQEEFING-ITDVDGVGANNSR
Q39477_CYACA/411-491 PSTITDLSVQIYRARLELSSTLGRDPTDAELADFLDISVQRLQDVKLYTNQSATVSLDAPVSRQVTNTC-IKSK-GTGDTDVF
O64419_CYACA/250-332 PNHVTESLRQIYRMRARLQHVLKRPPTDEEVAEACNMTLKRLKKITQHAWETQTLSLEGPPNSEAHSLYKSQQGEAPLSIGSI
Q9SLX4_TOBAC/343-423 PTYLHERLSLIRNAKARLEEKG-ITPSVNNIAASLNMSQKKVRNATEASSKMYSLDREAFPSLNGLPGETLHSY-IADNHLEN
Q9FPH1_ARATH/337-418 PTHLHERLGLIRNAKLRLQEKG-ITPSIDRIAESLNMSQKKVRNATEAVSKVFSLDRDAFPSLNGLPGETHHSYIADTRLENN
O24348_SORBI/335-415 PTYLHERLIAIRGAKYALEDQG-IAPTVENIAESLNISEKKVHNATEAVNKVLSLDQQAFPSLNGLPGDTLHSY-IEDQNVAN