EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04528 alignment
(12 sequences with 165 aa)


E434_ADEM1/130-283 RELVVQKFLLGTRFNEYYPQYRVHANRYVNPGLEYVGSVWC-GKHFIYVRADGAEFA-----RLKGLRARLGQGVLFCESLLSCYVVIVCQQCACPPTDAQVDHCMRLLSFTLRRWQNLLLGRSGSS-----PLIPGFDIPRNRTERLRQRMLHRFYSYRTPIYR
E434_ADE02/141-286 LASWFRMVVDGAMFNQRFIWYREVVNYNMPKEVMFMSSVFMRGRHLIYLRLWYDGHVG-----SVVPAMSFGYS-ALHCGILNNIVVLCCSYCA-DLSEIRVRCCARRTRRLMLRAVRIIAEE-TTA-----------MLYSCRTERRRQQFIRALLQHHRPILM
E434_ADE09/131-278 LAVWFRRVIYGCMFNQRFPWYRQIVNRNMPKEIMYMGSVFMRGRHLIYCRIWYDGHVG-----SIIPNMSFGWS-ALNYGLLNNMVIMCCTYCE-NMAEIRMRCCARRTRRLMLKAVGIIVRE-TCD---------PDPICSSRTEPRRQRLLRALMERHRPILF
E434_ADE12/131-276 LGRWFKMAVYGALINKRCFWYREVVNHLMPKEVMYVGSTFVRGRHLIYFKIMYDGHAW-----LALEKVSFGWS-AFNYGILNNMLVLCCDYCK-DLSEIRMRCCARRTRLLMLKVVQVIAEN-TVR-----------PLKHSRHERYRQQLLKGLIMHHRAILF
E434_ADE40/132-277 LANWFKMMIYGSLYNLRFPWYREIVNCGMPKEVLFMGSVFVRGRHFIYIRLLYDGHAA-----IVLERMSFGWS-FFSYGIMNNMVVLGCTYCK-NLDELSVRCCARRTRRLLAKAVKVLGSF-TVR-----------SLMRSLVEPRRQGLLRGLMERYCPFTL
Q98VN6_9ADEN/104-245 LKSIMYEFLRGMSVNQDFLFYREFVNKRLCNRILYQGSVMFRGLHLIYIRVKHWSDLVRV------TELDIQDA-VYCLGYTSWYVVLICRRCA-DEVNEYIHCCARRTRALLRSMADACDLL---------------DIRPSGREVERQRVLRYLLTKHPCICL
Q98VK6_9ADEN/107-247 IVGLFREVLNGTCYNNMFWFYREYVNRGMPERLLYTGSVMFRGIHLIFIRILLDSDSIRI------RKLNCGAC-VFYEGMYCNYLILMCKSCK-HMSEIQARVCARRTRLVLKRASLLCDGC----------------KGGSLKEVWRQRELLRVMKYGKNVSK
Q84211_ADEP3/1-157 MRSLMREIIRGCEYNRIFWWFREAVNLPSVSRVMYVGSVMFRGAHLMYIKIMYDCDLKLL------RMFHWGEV-IYCDGDYANYIVLVCRRCH-ELSEPVARRCAQRLRHWLKLAAEAIGAQRRGRKQQFTEGEWWSRQRDAEREEERQRALQECMVLGRSVSY
E434_ADECT/94-245 VQKVIEDFIKGGAMNKKYMWYREFVNSSRPDEINYVGSIIFRNTHYIYFRLSFFRTVHKACMEAIKRCINPELG-VVLKSTYNYWLVLKCKSCS-LQNYCSLKNCAVWVRSVIVRVLKEVEKT-----------PVVLHQTTSKAEERRQSALRQAMMHGRCRQI
E434_ADECC/100-251 LKEFLEEFVMGGFVNKKYLWYREFVNSSRPDEINYVGSIMFRNIHYIYFRLSFFSTVHQACMLAIQRCISPELG-VVFKSTYNYWLVLKCKSCS-LQNYCALKSCAFWVRSIIDRVLREVEKI-----------PVVLHRTTSKAEERRQTALKQAMMYGRCRHI
O71106_ADEB3/68-210 FQGLVKQCVHGAQFDRVYWYFRRELSKLSSVFLAYVGSVYVNNVHLIYFNSTFMIEE-----GSYIRCTPWGEC-LWVKGNSCIYLILICRSCN-PLTEMSVNCCLKRCKQKIRYMLNLAPKR---------------VKKHLGLARLRDRFLERLARFREPVLF
O71108_ADEB3/101-244 LMDLFKMCVAGTAFDTMFPFFRRELSKLSTRYIYYVGSVYVNKVHLLYFTNYVGASNQLL---KSLPTFAWGNV-YMGSGLDDKCIIIPCYDCA-ELSEVSASRCLLKVKEMIMCYLTCLPS---------------DHRYQCGLFEHRDKLIQRVAA-GEPVLK