EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04489 alignment
(4 sequences with 459 aa)


VU10_HHV7J/1-412 MAIA--ESGAFEINVNLGKSI--ASIQKNPIIYM---------RRHLSFYVELLKFIIHQYEQCFLPPKGTILYHNGLIELNTLIIDLNQQITSK-----QQIYSWTSITLPKIFSTKELYFIVASPESENITLNPAVTKGGWLSGSFSFPLS---LSCAYALTGVSSTIYMLPFIPYKFPMTY---------------VDFSTLRTYEVTSEYGSIQIIKQRNFLFLGIIRDLSW-KSQ-----RDNKNFILKAMFVGNWLGIQ--IP-EAFALRLFNNTRFSIQDFEFSINIQNINLTRDN-KILGSLSTVSCDQMPPNLSPENLPNYLVIQFELVSTLANPDHLLFSCNPKLFFTGDILNSAINLQHSPNHYELTVYAPHNLHFYPSCFHIVTLPIQFSSRNDRQ-MLVSSYPNEGYFEVQMCPWVQNSPLQIVIKSFSKNLVLPQGTPIAILLYM
VU10_HHV6U/8-436 TVSA--RSPTVTWSSGFGRAI--ASIQKRNQDNI---------RKPLRFYTGLLHCLIKQYEHCLVPPNKSIRFDKGKIEVAALILDLGHQVLGRQIHVRQRIYSWTSITLPKLFTPKELYFLIASPEEENIAFNPTITKGGWISGSFSYPVD---YRSNFSLTGMSANILMVPFVPYKYPLNYARFISS---------IDLMILNEQFPEHECGDIQILKQRNYLYLGVIKNLTW-KKSVTGTGQTAPHRILKASFIGSWPDTS--LP-DRVALRFFNNTRFTIHCHEFSINIENLGLVKNKEKVFGTLATVCCEQIPSLLTTENLPKYLIVQFEVVTQIEEPEPLLFSSNPKLYFTGDVLNATIQLQHNPNYYELLVHAPYDIHFYPSRCHIVILPIRYFTKPDKQ-ILISGYQNEGFFETQVMLWAPGTPLHITLRSFSPNLILPQSTKRRNRKAV
UL31_HCMVA/212-649 DPEQDYRLPAQDVVTSWIEALRDA--DRDNYGRCVRHAKIHRSASHLTAYESYLVSITEQYNTASNVTEK-ASYVQGCIFLSFPVIYNNTQGCG-------YKYDWSNVVTPKA-AYAELFFLLCSTSESSVVLQPLITKGGLCSSMAVYDEETMRQSQAVQIGFLHTQLVMVPFVPHACPHYAVPFTTPGKPGCGGAPSGVAGLEE---AAPFGRVSVTRHGATL-LCRVDHLTWISKRVTTYGHKKITRYL-AQFRGTMDDDEAALPGEDEAWIASKNVQYEFMGLIFTVNVDSLCVDAEQRQLLGTVATSFCHRVSDKITARNMPR--AFSFYLLTSAQRGYDLRFSRNPSLFFSGDALNCP--LLNEPNVFSLTVHAPYDIHFGVQPRQTVELDLRYVQITDRC-FLVANLPHEDAFYTGLSVWRGGEPLKVTLWTRTRSIVIPQGTPIATLYQI
Q9DWF8_RCMVM/314-728 DTSGECMREICDNLTKYTNSIDFATQDSRFQTNA-------SPRRHINSYRGRLLTIVCQYNQ-LVPDELRARYHKGGIHFSTTVMASPFHLPDGT------LHNWATMLTPRATGIPGGFFLLTSLKGNAAVCQPFITRGGTRAALVTYPSA---SSAPPPKKIVKLDLTCMFFTPFRIPEFGVRMIALDDPMF------------RAGGIAFGIMSPVKRTGATTVALFSGLTW-CIRTAIGEHGQMITTYAAWFECTQDNAY----GTCKFWRPGPPAVYECGEHEVTITVENMYVIHGGRKLIGTLAVRSDYFTAPSLRTEMMPSMLVLRFELYGVRHREPEIMFATNPTCHLAWPL---------GESEHEIHVYSPYDVQFKGGRHHF-SLDLRYFKPQHRRCFLVSVPQDETRFHTAMTVWRPDAPLRLTLVSHLPNLQLHRGTQVATLYLI