EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04438 alignment
(18 sequences with 33 aa)


Q9FRE5_ORYSA/185-214 RRHYCS--VC-GSTANYTCVRCGTRFCSCRCQV
Q9FHW2_ARATH/130-159 RRYFCS--VC-GYIAGYNCCLCGMRFCSIRCQN
ZNHI1_HUMAN/113-142 QRPFCA--VC-GFPSPYTCVSCGARYCTVRCLG
YB85_SCHPO/98-127 PRKFCN--VC-GYWGKYACQNCGTSYCSKGCEV
Q9CQK1_MOUSE/7-36 RTAVCV--VC-LEKPKYRCPTCRVPYCSVPCFQ
TRIP3_HUMAN/7-36 STVVCV--IC-LEKPKYRCPACRVPYCSVVCFR
Q9V7D9_DROME/1-30 -MEKCI--ICVDNLRKYKCSKCSAPYCSVACYK
HIT1_YEAST/4-34 SAVKCG--ICRGVDGKYKCPKCGVRYCSLKCYK
Q9SVU9_ARATH/5-35 ATQTCE--ICEKVVSKYKCPSCLVPYCSLGCFK
YEKJ_SCHPO/1-30 -MTTCS--ICNESEIKYKCPKCSFPYCSLPCWK
YHK0_YEAST/1-31 MAVLCG--VCGIKEFKYKCPRCLVQTCSLECSK
Q23644_CAEEL/80-110 DPKLCK--VCLKNEHKYKCPRCEMRTCSLDCSK
Q9FWC3_ORYSA/32-62 TRVICR--VCQKQFAQYTCPRCNARYCSLPCYK
Q99PT3_MOUSE/294-325 PAPRCSVPGC-PHPRRYACSRTGQALCSLQCYR
Q9I7G8_DROME/269-300 PSQVCFVSGC-ENRKTYNCSTTNVPLCSLTCYR
Q9M7X3_ARATH/388-419 PREKCVGPNC-EKAYKYRDSKSKLPLCSLGCYN
O22909_ARATH/445-476 PRENCVGPSC-TNPYKYRDSKTKVPLCSLKCYK
Q9H0W3_HUMAN/104-133 GEPICV--VC-GRYGEYICDKTDEDVCSLECKA