EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04420 alignment
(4 sequences with 193 aa)


Q9D1W0_MOUSE/12-164 LLVLSFVFGCNLLRILLPSL-SSFISRVLQ---KDAEQESQMR--AEIQGMKQELSTVNMMDEFARYARL-------ERKINKMTDKLKTHVKARTAQLAKIKWF-ISVAFYILQAALMISLIWKYYSV-----------------------PVAVVPSKW-ITPLDR--LVAFPTRVAGNCFLEIRWWWEIR
WRB_HUMAN/12-164 LLVLSFVFGCNVLRILLPSF-SSFMSRVLQ---KDAEQESQMR--AEIQDMKQELSTVNMMDEFARYARL-------ERKINKMTDKLKTHVKARTAQLAKIKWV-ISVAFYVLQAALMISLIWKYYSV-----------------------PVAVVPSKW-ITPLDR--LVAFPTRVAGGVGITCWILVCNK
Q9HGM2_SCHPO/6-165 ISTILLSLFIHFFDKFAKKRTIDGAYRIYVSVSNNKDLKKNKEILEQLLTVKKELNATSSQDQFAKWARL-------NRKYEQLSQEWEKQSANVKIFQDTFKRV-LSLFLWILTRGFRFYIQFKESKT-----------------------PVFFLPAFL--LPSWALWVLSLPRSIYGSVSLTVWNFAVQK
YGC0_YEAST/2-193 HWAAAVAIFFIVVTKFLQYTNKYHEKWISKFAPGNELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHKLRLLALTVPFFVFKIMYGKTPVYKLSSSTSTLFPTFVSGVWSQGWLYVLLHPLRTISQKWHIME-GKFGASKFDDMALQSVSLGIWVWALMN