EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04413 alignment
(19 sequences with 203 aa)


Q9X773_LEGPN/30-218 YRQRIGERFC-LGIQENAP--VDVWLHAVSLGEVIAATPLIDAMLN--KHWSVLVTTMTPTGSERVKSRFG.....HK--VAHQYLPYDLHRVLRRFYKRTEPRVGIIMETELWPNLIKQAHASGVALFLANGRLSDRSLQGYL..KLKFLFKPVLNQFSRILTQSNEDAERFIALGANADLVHVLGNMKFDLQIDSVDSSQY
Q9HUH7_PSEAE/31-221 YAKRIGERFS-LSLPEVPP--GGIWVHAVSVGESIAAAPMVRALLERHPQLPVTVTCMTPTGSERIRALFG.....EQ--VRHCYLPYDLPWAAARFLDRVRPRLAVIMETELWPNHIHACAVRGIPVALANARLSERSARGYA..RFAGLTRPMLAELSWIAVQTEAEAERFRRLGARPECVSVTGSIKFDLRIDPQLPLAA
KDTA_ECOLI/31-221 YRKRWGERYG-FYRHPLKP--GGIMLHSVSVGETLAAIPLVRALRHRYPDLPITVTTMTPTGSERVQSAFG.....KD--VQHVYLPYDLPDALNRFLNKVDPKLVLIMETELWPNLIAALHKRKIPLVIANARLSARSAAGYA..KLGKFVRRLLRRITLIAAQNEEDGARFVALGAKNNQVTVTGSLKFDISVTPQLAAKA
Q9CLD3_PASMU/31-223 YRKRLNERYG-FYCGAVPPKANGVVIHAASVGEVIAATPLIKRLQALYPTLPLTVTTVTPTGSDRVKAAFG.....DS--VTHFYLPYDLPDAVNRFIAFVQPKVCIVIETEIWPNLIVQLKKQAIPFIIANARLSARSTQRYH..WFKGALHHIFDHISLIASQDNVSAQRYLSLGYDAQRLKLTGNIKYDLVLNDALMQQV
KDTA_HAEIN/31-223 YRQRLAERYG-FYGNASCPPPQGIFIHAASVGEVIAATPLVRQLQQDYPHLSITFTTFTPTGSERVKATFG.....DS--VFHYYLPLDLPFSIHRFINFVQPKLCIVMETELWPNLIHQLFLRNIPFVIANARLSARSAHRYG..KIKAHLQTMWSQISLIAAQDNISGKRYATLGYPKEKLNITGNIKYDLNTNDELLRKI
Q9PH41_XYLFA/51-241 YFNRWNERYA-SYPAAYAR--PQVWLHAVSVGEVNAAASLVNALRQQRPDIRWVITTITPTGSERVRALWG.....DS--LEHVYLPYDVPGSVERFLRYFRPQLALILETELWPNLLFGCRSHGIPVYILNARLSVRSLRGYR..LLKPLIRRALRSVVCVAAQSQEDALRFLRLGARPDQVVALGNLKFDIPTPQDLDVFM
Q9KVB3_VIBCH/45-235 VGKRWKEHFGI--TPPLKTTTPPIWIHAASVGETLAVTPLIKQIKQRSPNTPILLTTTTPTGAEQAEKLAD.....---WVEHRYTPIDFSFAVRGFLRRVRPCQLIIVETELWPNTLHTVAKAGLPITLVNARLSEKSYRGYQ..RIHPFFNSMAKPLSLVLCQFADDAQRFIQLGVAETKIKITGSIKFDINITYEVIAQG
Q9JWS4_NEIMA/31-218 YRAHRGERFGKPYPNPVTG---AVWIHAVSVGETRAAQPLIRELRQRFPDAPLLMTQMTPTGRETAQVLFP.....D---AQCRYLPYDKKTWVRQFLREHRPMFGILMETEIWPNLMKECRRTGVPLFLANARLSEKSLNGYL..KVRSLIRPAAASLTGCLAQTEADAARLAKLGAAS--VQVCGNTKYDLMPSEQMKTLA
O52785_ACIHA/39-232 YQQECVERFG-PFQPPKNL--ATIWFHVVSVGETNAAQPLIEHYLK--LGHPVLVTNTTKTGQARAKSLFLkapylDL--FQAVYLPVDQKSLLKQFFELYQPKFLALVETEIWPNLIAEARQQQIPCILLNARLSEKSAKGYG..KVSRLTRPMLQQLTWLLAQDKATQQRYIELGLDRTKSQVVGNIKFDITAPQQFVEQA
Q9FFN3_ARATH/36-225 HFSRWPERFG-HPSAVRPPG-SLIWFHAVSLGEGMAAIPVIRHCNEVKSDLTILMTTTTVSAFEVIKNQLP.....VG--VLHQFAPLDTPLAIDRFLGHWKPNAIIIMENELWPNLIMAASGLLIPLGLLNARMSTKSFKRWSspLLLPLVSLLLSKFSLIA----PLGIRFQLLHAPPFVINYSGDLKYVVNKFHVSSGTS
Q9ABC8_CAUCR/35-223 DPARLAERLA-RADTPRPEG-PLVWLHGASVGESLSILPLVERLRAEKPEVTVLVTSGTTTSAALLAKRLP.....PG--AIHQYAPVDAPGAARRFIAQWKPDLAVFVESELWPNLLLEAKAAGTRLALVSAKLSDRSFASWS..TRPQAAYRLLSVFDLILAQDARAHQRFERLGGK---VAGEADLKFGATPLPVDAAAL
Q983L8_RHILO/38-225 DRHRRRERYG-VAGRPRPEG-PVIWIHAASVGETIAVVPLVESILD--YGVNIVLTTGTVTSAQVADERLG.....DR--IIHQYVPLDLKPAVSRFLDHWQPDLAIIAESEIWPMTILELGARHVPQVLVNGRLSDRSFTSWK..KRANIAEALFENLAHVVAQSDVDGERFRTLGARP--VTVSGNLKVDTNPPPVDERVL
Q9PPK0_CAMJE/30-205 YKISLKSRFF-LYKNLHQEK-ADVHFHACSYGEVRSIKALV-------LKFDSRITTITQTGFECAKEFCK.....-----KVNYLAFENFLPFW---LKPCKVLVIF-EAEYWLMLVFMARIYKAKIILLNARISDKSYHSYQ..RFSFFYKKIFSYIDEVFAQSDLDKARLESLGAKN--VKIFKNIKANLEIKNNKIYTK
O25611_HELPY/30-215 YRHSLKARFF-LKDNFLKSE-PVFWFHACSYGEVKSLEPIIHALKE-----PILISVTTNTGFELAAQTYQ.....HSKHIEVRYLPFETLLFAWKKNLKRLKTLVVT-EAELWFNVFDTAQKLGAKTMLINARISVRSYPKYQ..RFSFFYALLFKRIDLILAQSKEDKKRLLNLGAKK--VVDFLNIKRFSKPVITSFYPK
P71136_CHLAB/17-210 YTKSLGIRFG-FKKPEVPGTGPVAWFHGASVGETALLLPLLKQFMKDYPEWRCVVTSCTESGHENAHRLFG.....PLG-VTTFILPLDLSIIIKPVVRAIAPSLVVFSEGDCWLNFIEEAKRLGATAIIINGKLSANSCKRFT..ILKRFGRNYFSPIDGFLLQDEQHKARFLQLGVDKEKIEVTGNIKTYTETISENSQRD
KDTA_CHLPN/39-228 YKKSLAVRFG-LKKPHVPGEGPLVWFHGASVGEVRLLLPVLEKFCEEFPGWRCLVTSCTELGVQVASQVFI.....PMG-ATVSILPLDFSIIIKSVVAKLRPSLVVFSEGDCWLNFIEEAKRIGATTLVINGRISIDSSKRFK..FLKRLGKNYFSPVDGFLLQDEVQKQRFLSLGIP----EHKLQVTGNIKTYVAAQTAL
KDTA_CHLTR/36-225 YIDSWKIRFG-VQKPFVKGEGPLVWFHGASVGEVSLLAPLLNRWREEFPEWRFVVTTCSEAGVHTARRLYE.....SLG-ATVFVLPLDLSCIIKSVVRKLAPDIVIFSEGDCWLHFLTESKRLGAKAFLINGKLSEHSCKRFS..FLKRLGRNYFAPLDLLILQDELYKQRFMQIGIS----SDKIHVTGNMKTFIESSLAT
KDTA_CHLMU/35-228 YINSWKIRFG-VEKPQVKGEGPLVWFHGASVGEVSLLEPLLKKWRQEFPDWRFVVTACSEAGVYTAQRLYA.....PLG-ATVFVLPLDLSCIINPVVRSLSPQVVIFSEGDCWLHFLMGAKKLGAKAFLINGKLSENSCKRFA..FLKRLGRSYFAPLDLLVLQDKVYKQRFMQIGIPEDKIQISGNLKTFIETETSINNRS
O66663_AQUAE/1-175 MQFEVLKRFFP--KESLKNCKGALWVHTASIGEFNTFLPILKELKR---EHRILLTYFSPRAREYLKTKSD.....FY--DCLHPLPLDNPFSVKRFEELSKPKALIVVEREFWPSLIIFT---KVPKILVN------A---YA..KGSLIEKILSKKFDLIIMRTQEDVEKFKTFGAKR--VFSCGNLKFICQKGKGIKLKG