EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04386 alignment
(8 sequences with 163 aa)


SSPB_HAEIN/5-150 SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVK-DGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD------ELNIEPD-TEQPTGFYEAVDKPKKREEKKK--------.TKSVSHLRIVD
Q9CNA9_PASMU/5-160 SSPKRPYLLRAYYDWLVDNDFTPYLVVDATYVGVKVPVEYVK-DGQIVLNLSANATGNLVLSNESIQFSARFRGISQDIFIPMGAALAIYARENGDGVLFEPEAIYD------ELATQDIGVEQPLSFVEAVDKPKTSENTQKSTNKDKTTeKKATSHLRIIK
SSPB_ECOLI/6-165 LTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYAR-DGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYDEDTSIMN-DEEASADNETVMSVIDGDKPDHDDDTHPDDEPPQPP.RGGRPALRVVK
Q9KUE4_VIBCH/10-158 MTPRRPYLLRAFYDWLLENELTPHLVVDATLPGVKVPLEYVQ-DGQIILNVAPRAVGNLELGNDEVTFNARFGGRPHLVIVPIYAVQAIYARENGAGTMFEPEPAY---LDMMDFPEEIDSD-DSLIELESDVAVEHTEET------PRP-.RG-KPSLRVVK
Q9PEW6_XYLFA/9-146 MTSHRPYLLRALVEWINDNGMTPHILVDAGIQGVQVPESAVK-DGRVVLNIAGRAVMHLHIGNDGVSFNARFGGVSYPVQVPMQAVLAVYARETGQGMALPDDIQGE--------PPEDVPP-------PPETPSGGKDTS------PVS-.-GKRSHLRVVK
Q9HVY8_PSEAE/1-135 MNSSRPYLVRALYEWIVDNDCTPHILVNAEFAGVKVPPGYAS-DGQIVLNVSPSAVRHLHMDNEAVSFEGRFGGVAQSLYIPALAVMAIYARENGQGMVFDLEQPG---------PVDDEP---------GDDDGGPSDEP------PRP-.-SGRPSLKVVK
Q9JW84_NEIMA/2-130 PTSTKPYILRALCEWCSDNSLTPHILVWVN-EHTRVPMQYVR-DNEIMLNIGATATQNLQIDNDWISFSARFGGQAHDIWIPVGHVLSLFARETGEGMGFELEAYR---------------P--------DTSPENTSAET-----APRP-.--AKKGLKLVK
O52735_FRANO/1-135 MAMLRAYVVKATYNWLVDHGFTPYVLVDTEYEGVIVPANYIDEDKKILLDLSPQAIQDLVIDDNHISFAATFDSEPMSINIPIEAVLEVFSKETEQGMYAREFGYG------------------------ININEGEDDETAN----PKKLgETNSDNVLSLD