EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04376 alignment
(11 sequences with 116 aa)


ATE_CAUCR/8-96 RQLRFFLTAPTPCPYLPGREERKV--------------------------FAHLPLSDGPIVNDSLTQVGFRRSQNIAYRPAC-ETCRACQSARAPATEYILSRSERKILGRNDDL
ATE_RHILO/7-95 QSPQFFLTAPSPCPYLDGQFERKV--------------------------FTHLVGDKASEMNDLLTQGGFRRSQNIAYRPAC-ETCRACVSVRILAQEFTASRNMKRVLQHNSDL
ATE_PSEAE/5-93 ARLKFYATQPHPCSYLPEEQ-ATTL-------------------------FLDPSQPMDTQLYASLSEVGFRRSGDHLYRPHC-QHCTACIAARIPVADFSPNRQQRRILKRNAEL
ATE_XYLFA/9-97 DDLQLFKTNLHPCGYWPDRWASDL--------------------------VMDPNDPRLGAIYPQALAWGFRRSGNLLYRPHC-EHCNACVPVRVNVNAFVPNRSQRRCLARNATL
ATE_VIBCH/6-94 QQIRIGLTNNHPCSYLADRM-ERVA-------------------------VAIDPQMQTPETYEVLMANGFRRSGDTIYKPHC-DHCQSCQALRIPAPDFVPSKSQKRLLKLLSQE
ATE_CAMJE/1-88 MLEIGFCTLEDQCPYLKDKRSRIEY---------------------------KYIENCPKEINNELIKRGWRRFGRYFSRPIC-KDCDECLSLRILVNEYNFSRSERRVVNKNINT
ATE1_DROME/4-93 SIVSYYGSQQSKCGYCAGANCSLS--------------------------HGMHAYQLDCRDYQDLIDRGWRRCGYYCYKLRNQETCCPCYTIKCNGLEFKLSKSNKRILRRINRF
ATE1_HUMAN/16-100 PSEDFY-----RCGYCKNESGSRS--------------------------NGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKF
Q9C776_ARATH/23-113 SIVADCGRNKSTCGYCKSSTRFSIS-------------------------HGLWTERLTVNDYQALLDSGWRRSGCYLYKPEMEKTCCPSYTIRLKASDFVPSKEQQRVRRRIERF
ATE1_ARATH/19-109 SVIDDHGRRKSTCGYCKSPARSSIS-------------------------HGLSAQTLTVYDYQALIDRGWRRSGTYLYKHEMDKTCCPPYTIRLKASDFVPTKEQQRVSRRLERF
ATE1_YEAST/8-123 WAPSMHNEPAAKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIGSFVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISRFATR