EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04345 alignment
(3 sequences with 177 aa)


Q9CMB5_PASMU/7-170 LLQNATWQPSTDMQ-LPLSISSWLELSTSLTTQLKQAFG-EVNVCVLAESWITTLNENERQFFPKQACPCWCREVILKSQDIPLIFARTLIP-ASLLTQHSELQQLGNRALGEWLFMQSDRIRQKLELTHDKNT---------ALYARRALMSIGAENMMVAELFLT-PQIFTRVVK
Q9HTK1_PSEAE/1-175 MPSNALWLRADQLSSVSPAVLDWLFDEGSLTRRLTALADGAFRVEPLLEGWQTLRDDECQGLDVPTGSSGWVREVYLHGHDRPWVFARSVAARSALEGSGFDLALLGTRSLGELLFSDSAFERGPIEVCRYPAAGLPAEVRAEGLWGRRSRFSRGALGVLVAEVYL--PRLWDQAGI
Q9KVP6_VIBCH/15-183 ALNRVTWQQPDDIEFPAPLAQQWLLEQGSLSRRMATQCE-HLTVDLLSNQIMLADTLSYDETQLLASEEYLLRQVIIYGDQQPWVFGHTLIPRSSMHNQPFDFTQQGKIPLGLTVFSADNVKRDALQVGWVETELG-------RLLARRSRLWMNNKPMLVTELFLATSPIYSKERV