EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04340 alignment
(6 sequences with 233 aa)


Q9PD97_XYLFA/6-226 EV-KDKICAYDVAAWLRRHPTFLKQFPDLALTLVVPRENASTASLASYQLEVLREKNRELSRRLAALTGNAQANEQLAMRIHQLTLTLMRQRSAADTLRALVASLAEDFNGDCVRLVLLHPVAG--LQAAWLQVIESDDVRLVPFRDCLRDGEPICGRLNINKQVLLYAE-EASQVQSSALLPLS----G--LGLIAIGSYDPNRFYPGMGTLFLRMMGQALFDALK--RFDV
Q9KVL5_VIBCH/4-221 VT-ADALTAQVVAEYLYEHPDFFQHHPHLVERLALPTQTG-AVSLAHVQLARQRQRIDSLEEEITALMSLAANNDRTFHEFMDLQEQILKCSSLQAVLHAIEAKARELNLRAYVRLLQRHDEKY--G--------LASEDWQRFATNHFNGKSAYLGRLRQADRQRLLGDRPAPEMGSYVVLPLQ---RQAPLGILAFASEDGGHFQPSMDTLFLRHLALVLAHLIETLPWQS
Q51565_PSEAE/7-227 EP-TAALDAEQVAAYLSQHPEFFVEHDELIPELRIPHQPGDAVSLVERQVRLLRERNIEMRHRLSQLMDVARENDRLFDKTRRLVLDLLDATSLEDVVSTVEDSLRHEFQVPYVSLILFSDSSVSVGRS------VSSAEAHQAIGGLLSGGKTVCGVLRPHELAFLFGESDRDEIGSAAVVSLS---FQGLHGVLAIGSPDPQHYKSSLGTLFLGYVAEVLARVLP--RFSS
Q9CKC1_PASMU/1-227 MQ-KQSLTPTDIIDYLTQHKDFFLHHPEILDELNLHHTQNNTLSLVEMQLDRQRHRIQELEAELEKFTQLAIQNSDIFLGLLPLQQQLSQAHNLTEGIQKLDQWVKKFELQQ-AKILLFTDAWQK-GESLTDEVWLDRKAFEIVRLERFGLRRFYLGQMTHKEKTMLFLP-EEFPIGSVACCLLGGKTSQKPTALLLFSARDERHFHNGQDTEFLKHLVDIVTLHLG--RWVD
YIGA_ECOLI/10-233 ET-LTELDDRAVVDYLIKNPEFFIRNARAVEAIRVPHPVRGTVSLVEWHMARARNHIHVLEENMALLMEQAIANEGLFYRLLYLQRSLTAASSLDDMLMRFHRWARDLGLAG-ASLRLFPDRWRLGAPSNHTHLALSRQSFEPLRIQRLGQEQHYLGPLNGPELLVVLP--EAKAVGSVAMSMLG---SDADLGVVLFTSRDASHYQQGQGTQLLHEIALMLPELLE--RWIE
Q9AB86_CAUCR/7-225 ATRTMVVDPESVRDFLRTEPEFLRQDESLLGELGLRVDAANVVDFGPRALARAAAAHRREASVRQAIEANARANYSAQAQTHAAVIDMLDARNHSDLARRVDEMAQLRFGHAAGVIALEGPSRVP----------AGWRALAESQVDMLLGDAPIARMGFFAPALPLFDD-KAETIRSMAIVRMAIWEPRR-EALIAFGSTDPEGFTPDMGTELVNFLARVVERTAE--RWPV