EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04335 alignment
(30 sequences with 192 aa)


Y289_RICPR/72-239 IAFVVKSKQ.-FDPFVIQLNSNTGRAAVVEPISSSMLTVDESLTRYFIKKYITARETYNPVDFATIART-TVRLFSTSAVYYNYLGYIRNKDFDPTLK.YKEDNTTFLVIKSWSKIA-------.....-DDKYIVRFSVNETSGSQLV------YNKIAVVSYDYVPMQ.LTDSELDINPVGFQVNGYRVD
Q9KW47_9RICK/53-222 IFKISTSST.-IEPFVIEIDKKSGIVQLVDPVTVKQYSANETLNDYFISEYIKAREVFDPYNYNYNYYTK-VRLFSSPSVYSEFSNYIKSQNMNDLFN.LYSDAKGELKIRSIQKLG-------.....-NDALQVRFSIEFTRKDGNS----SRKNKIVVMSYKYASLE.MNDQQRYINPLGFQVISYRVD
Q9KW40_9RICK/53-222 IFKISTSST.-IEPFVIEIDKKSGIVQLVDPVTVKQYSADEALNDYFISEYIKAREVFDPYHYNYNYYTK-VRLFSSPNVYNEFRNYVGSQNMDDLFN.LYSDTKSEFKIRSIQKLG-------.....-NDALQVRFFVEFTRKDGSS----TRKNKIVIMSYRYASLK.MDDQQRYINPLGFQVISYRVD
Q9RPX7_BRUME/62-232 IAGMLPLKQ.-HVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWYTLQKDYET--VGMLSSPSEGQSYASQFQGDKALDKQ-.YGSNVRTSVTIVSIVPNG-------.....-KGIGTVRFAKTTKRTNETGD--GETTHWIATIGYQYVNPSlMSESARLTNPLGFNVTSYRVD
O50335_ECOLI/55-225 VCGIVGFSQpAPAPLVLRVDNATGAVDVVTTLREHESSYGEVVDTYWLNQYVLNREAYDYNTIQMNYDT--TALLSAPAVQQDYYKLFDGSNARDRV-.LGNKARITVRVRSIQPNG-------.....-RGQATVRFTTQQHNSNGTVE---RPQHQIATIGYTYIGAP.MRSSDRLLNPLGFQVTSYRAD
Q46703_ECOLI/56-228 LVGYVVHKYsQPIPAHLLTLNEATHEVQQVKLTRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTA--VALMSTPNVAESYQSKFKGRNGLDKV-.LGDSETARVKINSVILDK-------.....PHGVRTIRFTTVRRVRTNPVD--DQPQRWIAIMGYEYKSLA.MNAEQRYVNPLGFRVTSYRVN
Q9F250_ACTAC/48-225 TVSILPLRE.-VVPFLIRDNGT-GIPDVITRLDVETLTTDDAMDKHFISQYITNREGYYFNTXQQEYEL--TQMMSSDEVAKDYRSIYEGKNARDQK-.LGSSNTVKPEINSIVLSKKEVGTDG....qASNIATAR-VRLIQRNLSTGE--ETAKNIVVSLTYEYLPVKnMVEGFRMDNPLGFIVTHYRVD
Q9AGG9_ACTAC/48-225 IVSILPLRE.-VVPFLIRDNGT-GIPDVITRLDVETLTTDDAMDKHFISQYIKTREGYYFNTLQQEYEL--TQMMSSDEVAKDYRSIYEGKNARDQK-.LGSSNTVKPEIISIVLSKKEVGTDG....qASNIATAR-VRLIQRNLSTGE--ETAKNIVVSLTYEYLPVKnMVEGFRMDNPLGFIVTHYRVD
Q9RND0_BARHE/29-197 VAALTPLKT.-VEPFVIRVDNSTGIIETVSALKETPNDYDEAITRYFASKYVRAREGFQLSEAEHNFRL--VSLLSSPEEQSRFAKWYAGNNPESPQ-.NIYQNMIATVTIKSISFLS------.....-KDLIQVRYYKTVRELNDKE----NISHWVSILNFSYINAQ.ISTQDRLINPLGFQVSEYRSD
Q9PHJ3_XYLFA/53-222 VAALTPLKT.-TEPYVIRVNNNTGAVDVVKAMKEGKTNYDEAINKYFVQWYVRYRESYSRELAEDYYSY--VGIFSNDVEQQKYSAAFNPKNPQSPL-.NIYGTYAKVKIDIQSTSFI------.....HSNVALVRYTKKVERGLDQP----QITHWLATITFKYLNTP.MKEKDRGINPLGFQVSEYRND
Q9F527_ECOLI/68-239 IASLAPLKT.-AVPFLVRVDNSTGYTDIAPQLSDAKESYQDVETKYFLSKYLINYEAYDWQTIQEQADT--VKTMSSQKVFSAYDTMIRADSSPLNI-.LKNNYKIKVQINSVILLR-------.....-KDMAQVRFKKMVLDLSGKPAPGYRATEWISTISFDWDKDI.KTEKERLVNPLGLQVLSYQPD
Q981S1_RHILO/61-230 LILALPLKT.-YEPYMVVVDKSTGFVEVKRPLADGPLQQDESMGMFDIVRYVKARETYDPKALKDNFDL--AQLLSTGDASRELVELFSPANKVTNP-.VVLYGRNTVVAVTVKSVTFP-----.....NQRTALVRFMTEEKSQANTV----Q-RHWVSLIRFRYTGVP.AKNEIRFQNPLGFQVLEYRRD
Q9EUF3_ECOLI/57-235 LNAALPLKE.-TLVEAYLINSVNGVAERLTSVKKENLSENEALAKYFINQYVKRREGYNYFSLQHDYDY--VLLYSAENVATDYNALINGNNSPKVIY.KKAEQTATVQDDPSIILSSSSRADD.....KDKGAYIRFRLTIRDVATGTE---KQQYWNVRLTYRIEPQIeMASGERNNNPLKFVVTSYARD
VIRB8_AGRT9/51-218 IATMVPLSR.-LVPVYLWIRPD-GTVDSEVSISRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDL--VSNFSAPTVRQDYQQFFNYPNPSSPQ-.VILGKRGRVEVEHIASNDV------.....TPSTQQIRYKRTLVVDGKMP----VVSTWTATVRYEKVTS-.LPGRLRLTNPAGLVVTSYQTS
Q52608_9ZZZZ/51-218 IATMVPLSR.-LVPVYLWIRAD-GTVDSEVSISRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDL--VSNFSAPTVRQDYQQFFNYPNPSSPQ-.VILGKRGRVEVEHIASNDV------.....TPSTQQIRYKRTLVVDGKMP----VVSTWTATVRYEKVTS-.LPGRLRLTNPAGLVVTSYQTS
VIRB8_AGRTU/51-218 IATMVPLSR.-LVPVYLWIRAD-GTVDSEVSISRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDL--VSNFSAPTVRQDYQQFFNYPNPSSPQ-.VILGKRGRVEVEHIASNDV------.....TPSTQQIRYKRTLVVDGKMP----VVSTWTATVRYEKVTS-.LPGRLRLTNPAGLVVTSYQTS
O66288_9RHIZ/58-225 IATMVPLIR.-LVPVYLWVRPD-GTVDSEVSVSRLPATQEEAVVNASLWEYVRLRESYDADSVQYAYDL--VSNFSAPTVRQDYQQFFNYPNPSSPQ-.VILGKRGRLAVEHIASNDV------.....TPGVQQIRYKRTLVVEGKMP----VVSTWTATVRYEKVTS-.LPGRLRLTNPGGLVVTSYQTS
VIRB8_AGRT5/58-225 IATMVPLIR.-LVPVYLWIRPD-GTVDSEVSVSRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDL--VSNFSAPMVRQNYQQFFNYPNPTSPQ-.VILGKHGRLEVEHIASNDV------.....TPGVQQIRYKRTLIVDGKMP----MASTWTATVRYEKVTS-.LPGRLRLTNPGGLVVTSYQTS
Q9F595_AGRRH/58-225 IAVMLPLNK.-LVPVYLWVRPD-GTVDSEVSISRLPATQEQAVVNASLWEYVRLRESYSADTAQYAYDL--VSSFSAPTVRQDYQQFFNYPSPSSPQ-.TIIGKRGKLEAEHIGSNEL------.....MPGVQQIRYKRTLIMEGQAP----IVTTWTATVHYETVTN-.LPGRLRLTNPGGLIVTSYQTS
Q9RLR6_LEGPN/49-230 IGMLAHYQT.-VVPMLVHHYDN--GVTTVEPMENKLTPINRAQIESDIARYIQYRESYDASSYRAQFEL--VHLLSNSTVAKEYLQEQDAANTASPIHaLGNHIKREVRIYSINFLDSVLANEKdlhkdHHALAEVVFSLIDTDKTSGKT---TSTHYNAMISWRYTNPP.DSPETRWKNWDGFEVTRYSRQ
Q9ZN26_HELPJ/71-238 LISILPLQK.-TEHHFVDFLNQ-DKHYAIIQRADKSISSNEALARSLIGAYVLNRESINRIDDKSRYEL--VRLQSSSKVWQRFEDLIKAQNSIYVQ-.SHLEREVHIVNIAIYQQD-------.....NNPIASVSIAAKLLNENKLV----YEKRYKIVLSYLFDTPD.FDYASMPKNPTGFKITRYSIT
Q9ZEL0_HELPY/71-238 LISLLPLQK.-TEHHFVDFLNQ-DKHYAIIQRADKSISSNEALARSLIGAYVLNRESINRIDDKSRYEL--VRLQSSSKVWQRFEDLIKTQNSIYVQ-.SHLEREVHIVNIAIYQQD-------.....NNPIASVSIAAKLLNENKLV----YEKRYKIVLSYLFDTPD.FDYASMPKNPTGFKITRYSIT
O24879_HELPY/71-238 LISVLPLQK.-TEHHFVDFLNQ-DKHYAIIQRADKSISSNEALARSLIGAYVLNRESINRIDDKSRYEL--VRLQSSSKVWQRFEDLIKTQNSIYVQ-.SHLEREVHIVNIAIYQQD-------.....NNPIASVSIAAKLLNENKLV----YEKRYKIVLSYLFDTPD.FDYASMPKNPTGFKITRYSIT
Q9ZKL4_HELPJ/120-286 IVCLLPLKE.-KVPYLVTFSNA-TQNFAIVQRADKSIRANQALVRQLVASYVNNRENISSIKEQNEIAHETIRLQSAFEVWDFFEKLVSYEHSIYTN-.--INLTRKISIINIALIS-------.....-KTQANIEISAQLFHKEKLE----SEKRYRIIMTFEFEPIE.IDTKSVPLNPTGFIVTGYDVT
O25187_HELPY/182-347 LTILLPLKQ.-KEPYLVQFSNN-KENFALVQKADSSITANKALIRSLVGAYVLNRESITHIEQHEKMRQNTIKEQSSNEVWYEFEKLIAHYDSIYTN-.--PLLTRKVKIANIYLD--------.....-KDLAYIDIEVSLYHSGELE----SLKRYKVVMSFEFKKQE.INFDSMSLNPTGFMVTSYDVT
Q9KIS2_CAMJE/42-207 ITFLAPFKE.-VKPYLVFFSDG-ETNFVKVEQAGMDMRADENLLKSILAGYVKKRETINRVDDSERYEE--IRLQSQKNVWETFSNLVKAPNSIYTT-.--QGVFRSIEIINVSIFN-------.....-KNVATIDFIAKITNRDGSEN---HLKKYRATLFFDFIPME.LTYNSVPKNPTGFIVKQYSIT
Q9ZDP0_RICPR/72-239 INILLPIHK.-KVGYLIKDDSE-KQATITNTKHSTLANPYIAVANIMLQNYVKQREKYNYDTLKEQFTF--IKNASTSIVYMQFANFMNIDNSLSPVIrYQKLYRRSINIISINNIN-------.....-NNEATVTFESLAQNNTGEIL---ENMLWEARIGFIMDSIS.--TSTLQDMTFNFTVTSYKLK
O25265_HELPY/53-225 IVMMMPLKK.-TDIFVYGIDRYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQ---LMQYCDVSFQTQAMRMFNENIRQFV-.--DKVRAE-AIISSNIQR-----EKv...kNSPLTRLTFFITIKITPDTMENYEYITKKQVTIYYDFARGN.SSQENLIINPFGFKVFDIQIT
Q9JMX5_HELPY/53-225 IVMMMPLKK.-TDIFVYGIDRYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQ---LMQYCDVSFQTQAMRMFNENIRQFV-.--DKVRAE-AIISSNIQR-----EKv...kNSPLTRLTFFITIKITPDTMENYEYITKKQVTIYYDFARGN.SSQENLIINPFGFKVFDIQIT
Q9ZLU7_HELPJ/53-225 IVMMMPLKK.-TDIFVYGIDRYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQ---LMQYCDVSFQTQAMRMFNENIRQFV-.--DKVRAE-AIISSNIQR-----EKv...kNSPLTRLTFFITIKITPDTMENYEYITKKQVTIYYDFARGN.SSQENLIINPFGFKVFDIQIT