EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04311 alignment
(4 sequences with 341 aa)


Q9PHQ6_CAMJE/25-330 ISSYIEQKYH--FAFYPHNDLL--KEANGFKIKLEQIRAILS--NEPLPQTNEETTN-QENKSIDENLSKIDKVLNT---LENDENTSHKETNPTLIQDANISFIDNTK--LELQNGDEFLFIGDSLMQGVAIALNRDLRN----LNLKVTDLSKQNTGLSYKSYFDWSKATNEAFIKNSN-IKYLVVLLG--ANDPWD--IKKGGNYHRFGSLSWIDIYTSRVDEIIKIAKK-HKAKVFWFEIPPVKKEDLNKKIQVLNKIYSD------EILKNKEIFIN--TKLFFSV-NDEYSAYIKDENNRSIKVRTDDGVHFTPSG----AREMSKLLLEHIKLK
Q9JU60_NEIMA/26-317 INAYWQQTYHRNSPLEPLAAYG--WWRSGAALQENAYALSDG--IKAFLSGETPPTA-QDGGSADMPS-----------------EAAAPETAP---QTGETEWKQNTEA-AAVRTGDKVFFAGDSLMQGVAPFVQKSLKQQ---YGIESVNLSKQSTGLSYPSFFDWPKTIEETLKKHPE-ISVLAVFLG--PNDPWD--FPVGKRYLKFASDEWAQEYLKRVDRILEAAHT-HYVQVVWLGIPYMKKAKLDGQMRYLDKLLS-------EYLKGKIILIP--TAHTLSG-GKDRYTDSVNVNGKPVRYRSKDGIHFTAEG----QKLLAAKIMEKIVFE
O83576_TREPA/50-376 PAVYIRHKSVKNIYLAFVDPLMHTAEQWGIDTVFPLLRESFLHATGLIQHPEWEDTFYHCEQRSYEPAAALAESVPSP--VLQEAVAVSPPGVA--VNDSVAERKTTAPARVFSRTALRILMCGDSQMRYLTGGALQVLGTS---SHVQIQEVTVSSSGFVRTDYYHWPRKFLALLDTHTQQEPYAAVIMAFGMNDYQN-FYDADGSLCVTKTARWERAYEQKMRACLNIILH-TVPKVYLLGMPETRNKQLNEKLVYIEHVQKK---VVAQYDPQRVRYYS--LKPIVPGVHGTYASAIRDTHGRWVHVMHKDGIHYTIEGGAYVMETLLPLILADLERS
Q98H53_RHILO/28-353 PPLDIQKAKP--KPRKPRIPRAPVEPQTPIAEKAPDARIVLV--VGDFMASGLAEG--LDIAFADNPAVRIVARSNGSSGFVRDDFYNWPEQIK---SLIETEKPAAVVV-MLGSNDRQQMKVGDVREQPRSENWTKEYERRTDELGKAIATAKVPFLWVGMP-AFRVPKMTSDMLAFNDI-YHKAAESHGGEFVDVWDGFVDENGAFVTNGPDMNGQPVRLRADDGINVSKAGKRKLAFYTEKPLMKILGLAGPGSVAPATAPAGAPVEAPAPAAAPIVIDRTAPMLLSDPALDGGTELLGAAPPAKANPALPGEKLVIEGK---APEASPGRADDFSWP