EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04308 alignment
(4 sequences with 164 aa)


O34776_BACSU/14-172 QMTFQDVMERLKAFVQK---DPRSSYVLSIGTDSQVYRDYTKFITALHLHRTGKGAWGCLKNHTVDRPIHSLREKISLETAYSQETAAHILDGHLMDITDLLLPFTGEGADLTFEVHLDIG--KKGLTKDLIQEMTGRITSMGIEAKIKPDSYTAFSYANRFTK
Q9X1R8_THEMA/5-147 TWGKVDYRTVRELIKKF---TEGYKYSVFVGTDSDVKDGKVIYATALVVYRFGS-GATYFYTVYRDGNGKDLYSRIFKEAEM---SLEMAR--FVEEILKLGKP----------VVHLDIG--YEGLTKDLVSSVIGYVKGVGYPYQIKPDSFAATKIAHKHTK
Q97MM9_CLOAB/5-155 TFGDVSIDEMVSRIKEFILKDNNCNYKITIGTDSQNK-NLTKVVVVVAIHRIGS-GGIFFYDIKHVHKISNVRQKIYYETAL---SLELAS--------KVSHAFAEANIQEDIEIHADIGSNRKGKTYPLINEITGWITGEGYKYQIKPYSYAASCIADKISK
O66517_AQUAE/1-144 MPKFRDIEEVKEFIKTT---DKETS--IYVGCDSRQLRDKTIFVTVIVVHISSKYGAKVFWNVEKVPKINSLRQRLMEEVNR---AVYHAL--MLMDAVDGRH----------FEVHLDINPDENTASSVIVKEAVGYVLAQGLTPVLKPDAIAASCAADYITE