EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04268 alignment
(6 sequences with 160 aa)


Q9HTE5_PSEAE/53-204 RGDAAD-PAFAAAVHQALGLELPVALTLVASGET--SLQWLAPDEWLLIVPGGEEYAV-EQRLRQALGEELHYAVVNVSGGQTLLELSGANVRELLMKSTSYDVHPSNFPVGKAVGSIFAKSQCVIR----HTGEDTWELVVRRSFADYFWLWLQDASAE
SOXG_CORS1/47-196 RAVPGS--GGFAALAEAVGTGLPQQVGVVAGSVEGTAVLWLGPDEFLAIAP--EGAEL-AAELVAALGDEPG-QVLDLSANRSVLELSGPAAPLVLRKSCPADLHPRAFGVNLAITTTLANIPVLLW----RTGEQSWYILPRASFTEHTVHWLIDAMSE
Q98GZ2_RHILO/47-191 RA-PE---ASVTALSKALRLALPNKPKTSASKG-GRTALWLGPDEWLVID---EGGNDPLADCAEVTA--LH-SAVGISHRNIAISVTGPAAEATINSGCPQDLSLDAFPVGAASRTILGKAEIVLL----RTADDAFRVECWRSFSDYVFTFLSEGARD
Q986L5_RHILO/64-213 RGKAAE-MAKAAKGRFSVAA--PETPKAVGTQDA--TLIWSGPDQFFVLS--QGGKHA-MAALASSFAG-SA-SLSDQSHARVLISISGAKARAMLAKLSSIDLHADAFAIGAAAATSMDHTSVTLWRGADRDGSAVFNVLVFATFAESLWHTMLDSAAE
Q989Y3_RHILO/26-172 KALPEG--AIVHVLAAPREQDLASFLVGLGKGH----VHAVSPGQWFIVGDEPMTYSS-MKALFEMLEP-RA-TGVDQSGGRVRIRIDGRQSERILSTGTAIDLSAESFRVGQSATTLIGHIAAHIT----RIGSDSFELIVLRSFAESLWDDLTRVSAG
Q98KX5_RHILO/40-189 AAWPGEEKNLIATIRTVTGLTLPDGAGGGSSDG-VKSVFGFAPGKFTVAD---EAEGL-AAAFAKAVTPALG-TVTDLSHGRTAIRIAGPKAEWVLAKFFAIDFALPAFPVGAGRSTAHHDVFAQIQ----RTGADQFDIYVFRSFARSFWKALCHASEE