EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04265 alignment
(9 sequences with 76 aa)


TNR3_SCHPO/496-563 GIN---HVDCHDNIG--LHCGLLPVGQSVYVKKTSGLEWNIEDRICQFGG-LVSSC-NVVT-KATVTIEVNNFIVW
O80514_ARATH/181-249 HRH-EIHI--HSSLQGP-HCGLIPIGTPSANTTTSGLKWDLSNTEMRFGG-LISTS-NLVK-EEIITVESDSDLLW
TPK1_HUMAN/168-237 GKH-RLHV--DTGMEGD-WCGLIPVGQPCMQVTTTGLKWNLTNDVLAFGT-LVSTS-NTYDGSGVVTVETDHPLLW
Q8T4A5_DROME/258-328 GKHTIQVP--VDLVTSQRWCSLMPVGSSAHNVTTTGLKWNLYHAQLEFGG-MVSTS-NTYA-TEFVQVETDANLIW
THI80_YEAST/234-306 GTLIEYDPQFRNTCIGN--CGLLPIGEATLVKETRGLKWDVKNWPTSVVTGRVSSS-NRFVGDNCCFIDTKDDIIL
Q97NN8_STRPN/156-221 GISQLEPRSDYDYL------AFMPVRDS--QLTILGAKYELTEENFFF--KKVYASNEYIDREVSVTCPDGYVVVL
Q9CEL3_LACLA/138-203 GQHLLKRKLTYQYV------GFVQVETK-DSLAIEEAKYPLKAEDNFS---QIYASNEFISDQMKVSFNQGMVIVI
Q9A1H7_STRPY/139-203 GQHLIHQEEGMTYV------AFMAEGE--ADLTITGAKFELTQDNFFK---KKIYSSNAFIHQPITVSLPSGYLII
Q99UP5_STAAM/140-206 GQHTVEKDKSYPYI------SFIPMTDD-VELSLAGFKYNLARQMLNIGS-TLTIS-NEIESLQAKVTVHDGLILQ