EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04245 alignment
(4 sequences with 338 aa)


NDPA_PASMU/3-335 INVNEIVLHQITKSIEGDAMKLNTMLRERLLTITPEVEQMMLQLHQAYQNKS-KAYAVFNENS---LFAQDLNRFLEHESEFLDFSQKATALLVNELSRYPFADEGTLVLCRYNFLATDYLFIALLDSRASMLVDEQLEIHRTKYLEISQFDIAARLNLTELSLDAKSDRYLTFVKGRVGRKIGDFFMDFLGAEEGLNPQVQNQCLLQAVSDYCAQADLSKEQSQAVKKQVFEYCKGQMNVGEEIALTELSATMPTLNEQA-FASFAAEQAYGLAEHIPPVRSALKTLTKFSGSGKGITLSFDAELINQRVFWDEATDSLTIQGLPPNLRDQLQRQLK
NDPA_HAEIN/3-335 ITVNQTVLHQLVKNVDGDSIKMESVLRDELLSITPEVEQMMLQLHQSYQNKA-KAFGVFQEKS---IFAQHLNRLLEQEIEFLGFSQYSTKLLADELGKYNFAESGTLILCQYNFLATDYLFIALLDSRHSMLVDEHLDIRRTEYLDITQFDIAARINLTDLQVNANSNRYLTFIKGRVGRKISDFFMDFLGAEEGLNPQVQNQCLLQAVSDYCDQGELNKEQTQAVKKQVFEYCKGQLSNGNNIELRELSDSLPTLNEQP-FVVFTEKQNYGLEESIPPIRSTLKSLTKFSGSGKGVTLSFDAELLNTRIQWDPMTDTLTIKGLPPNLKDQLQKALK
NDPA_VIBCH/3-333 LFLSNVILHQLRKN-DNDELVVN--YRAESLRNDTSTENLVAELHRVFNAKAGKGFGCFKSDS---EFQLWLQEMRRGTLPFYEFSQQSAQRLKNELAKYPFADEGILVMAEYQSLATDYLFIGLLPLNQSLKVTEGLDISATDYLDINKMDIVARIDLSSYETDKESKRYLSYIKGRVGRKVADFFLDFLQADIGLDTKQQNQVLMQAVEDFCADAKFEKEEVISYKKQVYEYCNDQIKAGDEVRVQELSGELPPSNEGVNFFDFTREQGYQLEESFPADRSTVRKLTKYVGAGGGLNLSFDSLLLGERVFYDPETDTLTIKGTPPNLRDQLTR-LR
NDPA_PSEAE/1-332 MPIHHAIVHLIEKKPDGTPAVLH--ARDAELGDSQAIENLLADLNESYNAKN-KAWGFFQGESGAYPFSGWLGEYLEGDRDFVGFSREAVEHLQKLMEESNLSTGGHILFAHYQQGMTDYLAIALLHHSEGVAVNESLEVTPSRHLDLGQLHLAARINISEWRNNKQSKQYISFIKGKGGKKVSDYFRDFIGCQEGVDSPSETRTLLKAFSDFVESEDMAEEQAREKTETLVDYATSQARIGEPMTLDALSELMDDQQPRA-FYDYIRNKDYGLSPEIPADKRTLNQFRRFTGRAEGLSISFEAHLLGSKVEYDEERDMLIIRQLPTQLKDQLKR--R