EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04232 alignment
(5 sequences with 86 aa)


Q9RTU5_DEIRA/10-95 PEILKVSADSRPHSVAGAIAALLRSQGRVEVQAIGPAAVNQAVKALAIARGYLTEDGLDLSTQPAFVKLEVEQEERTAIKLGVYAY
SP5S_BACSU/1-86 MEILKVSAKSSPNSVAGALAGVLRERGAAEIQAIGAGALNQAVKAVAIARGFVAPSGVDLICIPAFTDIQIDGEERTAIKLIVEPR
Q9X0E9_THEMA/1-86 MEVLKVSSKSDPNKVAGAIAGVVREHGKAEIQAIGAGAVNQAVKAIAIARGYLAPSGIDLVFVPAFTDVEIENEKRTAIKFIVFPK
Q97IA2_CLOAB/1-86 MEVLKVSAKSQPKSVAGALAAVLRNSNSAEVQAVGAGAINQAVKAIAITRGFVAPNGIDLVVVPAFAEISIEGEDRTAIKFIVESR
Q9WZZ9_THEMA/1-86 MEILKVSSNSNPNKVAGAIAGSLTKSEKVEIQAIGAGAVNQAVKALAVARRFLEESGKDLFVVPGFIEIKIGDDVRTGISFKVFLE