EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04223 alignment
(5 sequences with 468 aa)


Q99ZK7_STRPY/45-510 dSKLLGSVREAIEKTGLTDGMTISFHHHFREGDFIMNMVLEEIAKMGIKNLSIAPSSIANVH-EPLIDHIKNGVVTNITSSGLRDKVGAAISEGLMENPVVIRSHGGRARAIASGDIHIDVAFLGAPSSDAYGNVNGTKGKATCGSLGYAMIDAKYADQVVILTDNLVPYPNTPISIPQTDVDYVVTVDAIGDPQGIAKGATRFTKNPKELLIAEYAAKVITNSPYFKEGFSFQTGTGGASLAVTRFMREAMIKENIKASFALGGITNAMVELLEEELVEKILDVQDFDHPSAVSLGKHAEHYEIDANMYASPLSKGAVINQLDTCILSALEVDTNFNVNVMTGSDGVIRGASGGHCDTAFAAKMSLVISPLIRGRIPTFVDEVNTVITPGTSVDVIVTEVGIAINPNRQDLVDHFKSLN-VPQFSIEELKEKAYAIVGTPERIQYGDKVVALIEYRDGSLMDVVYNV
Q9CGA7_LACLA/46-510 .NKLVDSLEEVVLKT-VKDGMTISFHHHFREGDYVFNKVMRIIIDHGFKDLRIAPSSLTNVMNDILVEAIEKGVVTNITSSGMRGTLGDVVSHGALKNPVIFRSHGGRARAIETGEIHIDVAFLGTPNADEMGNANGMDGKAPFGSLGYALMDAQYADTVVAITDSLVSYPNTPASIKQTQVDYVVKIDAVGNPDKIGAGATRFTKDPKELKIASMVNDVIVNSPYFKNGFSFQTGTGGAALAVTRFLRQSMIDHNVKATFGLGGITKPMVDLLEEGLVDKLMDVQDFDGGSAQSMHLNKNQQEIDASWYADPANKGAMVDKLDVVILSALEIDTKFNVNVMSGSDGVIRGAIGGHQD-AGTAKLTIISAPLVRGRIATVVPDVTTVITPGDSIDVLVTEIGIAINPKRTDLLDKLSNIPGLPVYTIEELQKIAEEKLGKPEPLEFTDKVVALIEYRDGSLLDIIREV
CILA_HAEIN/33-498 dRKLCTSLEEAIKRSGLKDGMTVSFHHAFRGGDFVVNMVMNKIAEMGFKNLTLASSSLIDSH-FPIVEHIKNGVVTKIYSSGLRGELAEQISRGLLNEPVNIHSHGGRVHLVKSGELKIDVAFLGVPCCDTFGNANGFTGKSKCGSLGYARVDAEYADKVVLLTEEFVEYPHHPISIAQDQVDLIVQVEAVGDPKKIGGGATRMTTNPRELLIARKCAEVIFASGYFKDGFSLQTGSGGAALAVTRFLEEKMRRENITADFALGGITASMVALHEAGLIKKLLDVQSFDSVAAESLARNPNHIEVSANQYANYSSKGASVERLDMVILSALEIDTKFNVNVLTGSDGVIRGASGGHCDTAASAQVAIIVAPLVRGRIPTVVENVITCVTPGENVDILVTDHGVAVNPKRPDLIEALSKTD-IPLFTIEQLCERAYSITGKPKEIEFTNKPVAVVRYRDGSVIDTVYQV
CILA_ECOLI/43-508 dRKLCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLTLASSSLSDCH-APLVEHIRQGVVTRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVAFLGVPSCDEFGNANGYTGKACCGSLGYAIVDADNAKQVVMLTEELLPYPHNPASIEQDQVDLIVKVDRVGDAAKIGAGATRMTTNPRELLIARSAADVIVNSGYFKEGFSMQTGTGGASLAVTRFLEDKMRSRDIRADFALGGITATMVDLHEKGLIRKLLDVQSFDSHAAQSLARNPNHIEISANQYANWGSKGASVDRLDVVVLSALEIDTQFNVNVLTGSDGVLRGASGGHCDTAIASALSIIVAPLVRGRIPTLVDNVLTCITPGSSVDILVTDHGIAVNPARPELAERLQEAG-IKVVSIEWLRERARLLTGEPQPIEFTDRVVAVVRYRDGSVIDVVHQV
Q9KTT9_VIBCH/66-531 sRKVKSSIREAIVDLGLKDGMTISFHHAFRGGDKTVNLVMEVIAELGIKNLTLASSSLTSCH-SPLIEHIKNGVVSKIYTSGIRGALADSISNGLLDEPVHIHSHGGRVHLIQSGELYIDMAFIGVPCCDEFGNANGFKGKSNCGSLGYAKVDAEHAEKVVMLTEAIVGFPNFPASITQDRVDAVVQVAEVGDPSKIGGDATRMTTNPRELLIAKRAAEVIEHSGYFYDGFSMQTGSGGASLAVARFLKEKMLRQDIRASFALGGITATMVDMHEQGLIDYLLDVQCFDSVAAGSLARNPHHLEISANEYANPSSKGAAVDRLDVVILSALEIDTQFNVNVITGSDGVIRGASGGHCDTAAAANLSIIVAPLVRGRIPTVVEKVTNVITPGSTIDVLVTDQGIAVNPNRPELKARFIEAQ-LPVVEIEALQQRAELLTGKPQPLQFEDKTVAFVHYRDGSIIDVIKQV