EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04193 alignment
(32 sequences with 67 aa)


YD03_SCHPO/149-204 ATVL-----------VNIGFLPQYISIFRARAVTGISYLFLAIDSSGSLFSFLSLPFDRWDVLAAVD
Q9C2L0_NEUCR/167-229 LDAI-YAVSYVKLVVTLIKYTPQVIVNYRNRSTEGWSILQILLDFGGGILSIAQQAIDSYQ---QGD
ERS1_YEAST/162-212 KISM-----------SLIKYIPQVTHNSTRKSMDCFPIQGVFLDVTGGIASLLQLI-----WQLSND
YD03_SCHPO/18-81 ASTV---FAILGTVCWCVQLIPQIIKNYRAKSTEGLDTLFILSWVVASIPLSVYNQVQELNIALKVQ
Q03193_YEAST/5-69 KAAT--ALATIATVCWCVQLIPQIIYNWKKKDCTGLPPLMMFLWVVSGIPFAIYFCVSKGNVILQVQ
YBZ7_YEAST/10-76 AKNLSGMAGSISICCWIVVFVPQIYENFRRQSAEGLSLLFIVLWLLGDIFNVMGAMMQNLLPTMIIL
Q12010_YEAST/10-76 RSTLSGISGSISISCWIIVFVPQIYENFYRKSSDGLSLLFVVLWLAGDVFNLMGAVMQHLLSTMIIL
STM1_SCHPO/14-80 LTELSSFLGALSLGCWVVLLIPQLLENYKNQSGESISDLFLIIWLIGDFFNVLGSIYGNVSSTVLVL
Q06328_YEAST/8-71 WPTVSNLCGSLSFFTSVISLFPQIIETYRDKSVDGLSPYFLLAWLCGDITSLIGA---KLTGQLLFQ
O80679_ARATH/8-74 RDGLSLSLGIISVISWGVAEIPQIMTNYSEKSTEGLSITFLTTWMIGSARSLSSSHTPPAGSVLAQR
O49437_ARATH/3-69 RDDLSLSLGIISVISWSVAEIPQIMTNYNQKSIEGVSITFLTTWMLGDIFNVVGCLMEPASLPVQFY
O23198_ARATH/30-96 NDDVSFALGIASLLCWGVAEIPQVITNFRTKSSNGVSLSFLLAWVAGDIFNLVGCLLEPATLPTQFY
Q9D2V1_MOUSE/178-233 AVLTEAMLG-----------VPQLYRNYCHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQFSVC
YBZ7_YEAST/215-270 SAIL-----------YLGSRIPQIVLNFKRKSCEGVSFLFFLFACLGNTSFIISVLSASWLIGSAGT
Q12010_YEAST/219-274 SALL-----------YLGSRIPQILLNFKRKSCEGISFLFFLFACLGNTTFIFSVIVISLDWKYLIM
STM1_SCHPO/185-239 SSVL-----------YFCARIPQIIKNHKAKSTEGLSIIFFVLASVGNTSYAFSILVFPAS-DYLNY
O49437_ARATH/187-242 MAAI-----------YMGGRLPQICMNVRRGNVEGLNPLMFFFAFIGNVTYVASILVNSVEWSKIEP
O23198_ARATH/266-321 MAAI-----------YMGGRIPQIWLNIKRGSVEGLNPLMFIFALVANATYVGSILVRTTEWDNIKP
Q06328_YEAST/185-247 GTIL----SWIGASFYVGARIPQLIKNYNRKSTDGLSPFLFATTLLCNITYNLSIFTSCRFLDNQNK
MPU1_ARATH/150-205 KHLI-----------FLSARIPQIWKNFRNKSTGQLSFLTCLMNFGGALARVFTSIQEKAPLSMLLG
ERS1_YEAST/1-67 MVSLDDILGIVYVTSWSISMYPPIITNWRHKSASAISMDFVMLNTAGYSYLVISIFLQLYCWKMTGD
CTNS_HUMAN/123-189 ISIINQVIGWIYFVAWSISFYPQVIMNWRRKSVIGLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQ
CTNS_ARATH/9-75 LEISYEIVGWIAFASWSISFYPQLILNFRRRSVVGLNFDFVMLNLTKHSSYMIYNVCLYFSPVIQKQ
CTNS_DROME/128-194 LIYTSIIFGWVYFVAWSVSFYPQIWSNYRRKSVEGLNFDFLALNIVGFTLYSMFNCGLYFIEDLQNE
CTNS_CAEEL/125-191 LAILIQIVGWTYFFAWSISFYPQMYLNFKRKSVVGLNFDFLSLNLVGFCAYAIFNLLMYYNSHVKNE
Q9VZF3_DROME/22-84 ADLL----SLITVSSCLVIKVPQINTIRANESSKGISVLGLCLELFSYTVMLSYNYTSGYDFLSYME
MPU1_DROME/34-100 KALLSKGLGLAIIAGSVLVKVPQVLKILNSKSGEGINIVGVVLDLLAISFHLSYNFMHGYPFSAWGD
MPU1_CRIGR/39-105 KILLSKGLGLGIVAGSLLVKLPQIFKILGAKSAEGLSLQSVMLELVALTGTVIYSITNNFPFSSWGE
MPU1_CAEEL/30-96 KAVLSRGLGFAITLGSILLFVPQILKIQAARSAQGISAASQLLALVGAIGTASYSYRSGFVFSGWGD
MPU1_ARATH/27-93 LPLISKLLGYFLVAASMTVKLPQIMKIVDNKSVKGLSVVAFELEVIGYTISLAYCLNKDLPFSAFGE
Q9XXN5_CAEEL/31-88 FFII---------VGGSIPYVFQYVEIHHRRNASGFSLFVCLALCVANILRILFWFGKWFDNALLAQ
Q9CYA7_MOUSE/14-80 HQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVANILRILFWFGRHFESPLLWQ