EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04157 alignment
(3 sequences with 167 aa)


Q9VD72_DROME/88-253 VLGMGDFYYELGVQVVEVCLAANHKTGGLMELDDLRRRLIAARGQSSVHQEITKEDILMAAKKLSIFGNGFVVHKLGKGKYIVQSIPGELSMEETNILNAASNTEQGCVTQSQLIKDLGWTDYRAQQSLDKVLGEGLCWID-KQAGDEPAYWFPSLFPGRNAQTTAA
Q9SZ43_ARATH/20-181 LLGIGDFYYELGVQIIEVCMLTRSHNGGLISLQELCNHLRQRRKKD--REAVTEDDCLRAISKLKVLGSGFEVITIG-KKKLVRSVPTELNKDHNQILELAQ--GQGFVIVEEVQRRLSWTSGRVIDALETLLEEGLAMIDNGHKDGKCRYWFPCVSSVYSSIGSDT
O94663_SCHPO/89-249 AVGMNEFYYQVAVRVIEVCYATQMENGGLLSVSQVCRFLNEENEAFG-HEWLRETDVVRAVDSLAPLGPGFVLEKIA-GKQYIRSLPLELNTDQNVVLEAVE--ILGYVTISILRDNYAWERSRCIQVLNDLVSKSLLWID--SQGVEMAYWGASNLIDDQAQRFLY