EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04131 alignment
(7 sequences with 201 aa)


NANE_BORBU/29-229 MSKMALAAKIGGAIGIRANGVNDISQIKLEVDLPIIGIIKKNYNNCDVFITPTMKEIDELCNEGVDIIALDATFRNRPDGVLLDDFFENIKKKYPKQCLMADISSLDEAINADKLGFDFIGTTLYGYTKNTNGlNIADNDFNFLRTLLNSNLKSTLIVEGKIDTPLKAQKCFEMGVDLVVVGGAITRPAEITKKFVEKINQ
NANE_STRPY/38-234 MPLMAKAAQEAGAVGIRANSVRDIKEIQAITDLPIIGIIKKDYPPQEPFITATMTEVDQLAALNIAVIAMDCTKRDRHDGLDIASFIRQVKEKYPNQLLMADISTFDEGLVAHQAGIDFVGTTLSGYTPYSR-.QEAGPDVALIEALCKAGIA--VIAEGKIHSPEEAKKINDLGVAGIVVGGAITRPKEIAERFIEALKS
NANE_LACLA/34-230 MPLMAKAAAQAGAVGIRANSVRDIKEIQKIVDLPIIGIIKRDYPPQKPFITATMKEIDELVATSCEVIALDCTSRERYDGLTINEFIKSIKEKYPNQLLMADCSTFEECKNAYEAGVDFVGTTLSGYTDESP-.KQDEPDFTLLEKLVEEKIP--VIAEGRIHSPEQAKRVYDIGVDAMVIGGAITRPFEIATRFIKAIGE
NANE_PASMU/35-226 VAAMAQASVIGGAAGLRIEGIENLKATRNVVNVPIIGIVKRDLPDSPVRISPFLQDIEELAAAGADIIAFDGTDRVRP--TTREAIIKRIKELG--CLAMADCSNFEEGMYCHNLGVEIIGSTMSGYTGGEIP.--AEPDYQLVKDLNAAGCR--VMAEGRYNTPELAKTAIEIGAYSVTVGSALTRLEHIVSWFADAVKS
NANE_HAEIN/35-226 VSAMAQASVMGGRSGLRIEGVDNLKATRPFVNVPIIGIVKRDLPDSPVRITPFLQDIEDLANAGADIIAVDGTSRPRP--VDIESAVKKIHEMG--CLAMADCSNLEEGLYCKALGFDIVGSTMSGYTGGAVP.--EEPDYQLVKDLKSAGCF--VMAEGRYNTPELAKVAIEIGADCVTVGSALTRLEHIVSWFANSVKS
NANE_ECOLI/35-226 VAAMALAAEQAGAVAIRIEGVANLQATRAVVSVPIIGIVKRDLEDSPVRITAYIEDVDALAQAGADIIAIDGTDRPRP--VPVETLLARIHHHG--LLAMTDCSTPEDGLACQKLGAEIIGTTLSGYTTPETP.--EEPDLALVKTLSDAGCR--VIAEGRYNTPAQAADAMRHGAWAVTVGSAITRLEHICQWYNTAMKK
NANE_VIBCH/41-232 IVAMAIAVEQAGAKALRIEGVNNVAAVSAAVTIPIIGIVKRDLPDSPIRITPFVSDVDGLANAGATVIAFDATDRTRP--ESRERIAQAIKNTG--CFAMADCSTFEDGLWANSQGVEIVGSTLSGYVGDIEP.--TVPDFQLVKAFSEAGFF--TMAEGRYNTPELAAKAIESGAVAVTVGSALTRLEVVTQWFNNATQA