EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04102 alignment
(8 sequences with 69 aa)


SLYX_XYLFA/12-78 AFEARLIELETRVSFQEQALTEISEALAETRLIGARNAELMRHLLEELGKVRN--TLYEHPIDEPPPHY
SLYX_RHILO/1-67 MPADRLTTLEIRAAEQERTIEELSGQIAEQWTVIERMQRKLDALTDRFLALEE--QAAPDVPVTKPPHW
SLYX_PSEAE/2-69 ELDARMDDLECRQAFQDDTLQALNDVVVEQQRSIERLQLQVAALIKRLEDVQGLVGEAGE-DEAPPPHY
SLYX_VIBCH/5-72 QLQERIEDLECKLAFQEQTIETLNDALTQQQLLLSKMQDQMKYVVGKVKNMDT-STLADPAHETPPPHY
SLYX_ECOLI/5-72 SLEARLAELESRLAFQEITIEELNVTVTAHEMEMAKLRDHLRLLTEKLKASQP-SNIASQAEETPPPHY
SLYX_HAEIN/6-73 MLENRIEELEMKIAFQEQLLDELNHALVQQQFDIDKMQVQLRYMANKLKDFQS-SNIASQSEETPPPHY
SLYX_PASMU/6-73 TLEQRIAELEMKTTFQEKLLDELNQVIVEQQFAIDKIHVQLRYLVNKFKDMQP-SNIASQAEETPPPHY
SLYX_NEIMB/6-74 ELERRIVELEIQSALQEDVIAGLNAMVAELRQTLDLQQAQLRLLYQKMQDRNPDAQEPYSLRDEIPPHY