EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04096 alignment
(3 sequences with 188 aa)


NU145_YEAST/442-624 LNKQDGENTLQHEKSSSFGYWCSPSPEQLERLSLKQ---LAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVDKKTKKPMKDTTKFAEFQVFDR--KLRSMREMNYISYNPFGGTWTFKVNHFSIWGLVNEEDAEIDEDDLS
NU189_SCHPO/777-953 QNEADGSLKKDEHVVLSDDYWMKPSIEELSKYPKEK---LCSVHQFSVGRTGYGQVAFLKPVDLSGFE--KLEDIPGKVVVF-ERKICAVYPVEGSSPPLGEGLNVPAIITLEKTWPLSRETREPIKDPQNPR---YIQHVKRLHRIKDTEFIDFN--DGKWIFKVQHFSRYGLLDDEEEENDMSSTS
NUP98_HUMAN/727-899 YHMHPAGII-----LTKVGYYTIPSMDDLAKITNE-KGE-CIVSDFTIGRKGYGSIYFEGDVNLTNLN---LDD----IVHI-RRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKT