EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04083 alignment
(13 sequences with 72 aa)


Q20449_CAEEL/27-98 DDPELNMNTSQIIERWGYKAEVHTVTTEDGYILQMQRIPYGKTSVTWpNGKRPVILLQHGLLACASDWVDNL
O61866_CAEEL/21-92 GDPELHMTTPQIIERWGYPAMIYTVATDDGYILEMHRIPFGKTNVTWpNGKRPVVFMQHGLLCASSDWVVNL
LIPG_BOVIN/26-96 KNPEASMNVSQMISYWGYPSEMHKVITADGYILQVYRIPHGKNNANH.LGQRPVVFLQHGLLGSATNWISNL
LIPG_MOUSE/26-96 KNPEANMNVSQMITYWGYPSEEYEVVTEDGYILGVYRIPYGKKN-SEnIGKRPVAYLQHGLIASATNWITNL
LICH_MOUSE/27-97 VDPEVNMNVTEIIMRWGYPGEEHSVLTGDGYILSIHRIPRGWKNHFG.KGPRPVVYLQHGLLADSSNWVTNI
LICH_HUMAN/29-99 VDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSD.KGPKPVVFLQHGLLADSSNWVTNL
O17766_CAEEL/21-92 IDDECYMTVPEIGKHFGYESEVHLVRTTDEYILELHRIPCKQNEKCDrSSKRPIVFMQHGLLADGFSWIPNL
Q9VKT9_DROME/63-125 IQEDSHLNTYSLIKKYGYPAENHTLETDDGYILTLHRIAR-------.-PGATPVLLVHGLLDSSATWVMMG
Q9VKT2_DROME/34-96 VIEDAHLNTIQLLEKYKHPAETHQVTTDDKYILTLHRIAR-------.-PGAKPVLLVHGLEDTSSTWIVMG
LIP1_DROME/60-122 IKQDSTLSVDKLIAKYGYESEVHHVTTEDGYILTMHRIRK-------.-QGAPPFLLQHGLVDSSAGFVVMG
Q9LPR1_ARATH/24-79 FNFSYNLDR--------YPYEAIRVVTSDGYGLLLERIP--RRD---.--ARKAVYLQHGVMDSSMGWVSNG
O60095_SCHPO/67-138 NKLTDARDTIDLCALHGYDLEEHFVRTTDGYLLGLHRVYKKKKGKIEeLNYLPPVLFIHGLMMNSESWVCNL
Q9SKL5_ARATH/26-92 GSPVNSLCA-DLIHPANYSCTEHSIQTKDGYILALQRVASLGPR---.LQSGPPVLLQHGLFMAGDVWFLNS