EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04077 alignment
(7 sequences with 98 aa)


O87898_CHRVI/9-100 KSPFERNS---LESCLKFATEGASVLLFEDGIYAALAGTRVESQVTEALGKLKLYVLGPDLKARGFSDERVIPGISVVDY---AGFVDLTTECDTVQA
Q9I0N1_PSEAE/10-99 RSPFNDGR---LGSCLYLLNPGDGLLLCGDAVHALLAGSHACQALELMPAEIELFALLEDLQARGIED--VPARLVAVDY---PGFVELATRFDKVNS
YHEL_ECOLI/7-94 RSPWLTD----FAALLRLLSEGDELLLLQDGVTAAVDGNRYLESLRNAP--IKVYALNEDLIARGLTGQ-ISNDIILIDY---TDFVRLTVKHPSQMA
Y530_BUCAI/2-89 KSPFETN----VSLVISMLKKSDDFLALQDGVLIALKDNIFLKSIIMSP--VKLYLIKEDVYARGIRKN-ISREFILINY---IHFVSLTLKHKKQMT
Q9KV00_VIBCH/4-90 IVKHLEK----LPLLSAYLLDGDVVLLTENAVYAAAVHSPYQASINDQN---LWLVLYEDLHARGWLEK-CDPRISVVTM---SDFVDLTVTHDKSIT
O27413_METTH/10-106 KSPSELSFKTFLDLVDIWCEEYLKVYLISNGIYAAMEGNRYSHTIREISRTGNVFARKEDLMARGITRE-MLIDGVEVLEGLDRVVVDIMENLDMVFT
Q9X074_THEMA/1-87 MALVLVK----YGTDHPVEKLKIRSAKAEDKIVLIQNGVFWALEELETP--AKVYAIKDDFLARGYSE--EDSKVPLITY---SEFIDLLEGEEKFIG