EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04060 alignment
(20 sequences with 35 aa)


Q50745_METTF/141-175 LLQDLNCGKCGFESCREFAKAKVQGDADDTNCKSQ
O27594_METTH/141-175 LLQNLNCKKCGFSSCREFREAKIRGEADDIDCRSQ
ACSC_MOOTH/10-44 QLPKKNCGECGTPTCLAFAMNLASGKASLDSCPYV
Y119_METJA/20-54 YLPGFNCGACGYKRCDLFAEALLNKDVKLEDCPFL
ACDG_METJA/13-47 LLPKTNCKKCGYPSCMAFATKLLEKEATIDQCPIL
ACDG_METTH/11-45 LLPKTNCGKCNEASCMAFATKLIEKEVTLDDCPQL
O28624_ARCFU/11-45 LLPKTNCKKCGEATCMSFAFKLLNREKKLEDCKPL
O28038_ARCFU/117-151 YLPKTNCKRCGEQTCMAFAVKLLNGEVDIKACKPL
O27412_METTH/137-171 CLPGSNCGDCGESTCMAFAMKLLNGEQKLDSCLPL
ACDG_ARCFU/12-46 YLPRTNCGECGFDTCMSFAAHILDRSVTPLDCKPL
ACDG1_METTE/12-46 YLPQTNCGECGEPTCMAFASKLIDRSGKTSDCPPL
O74080_PYRHO/156-189 MLPNIDCGLCGFN-CEQMAKLIVKGEKSVNDCVVL
RNFB_RHOCA/40-74 ILPGTNCGACGFPGCNGLAEAMAEGNAPVTACTPG
Q9PFW0_XYLFA/36-70 LLPQTQCGQCGFQGCLPYAQAMARGEANIDRCPPG
Q9JX52_NEIMA/11-44 LLPQTQCRECGYDGCLPYAQAVATGEA-YNLCAPG
RNFB_BUCAI/39-73 LLPQSQCAQCGYSGCYPYAKAIVENSEKINKCIPG
RNFB_PSEAE/43-76 LLPQTQCGQCGYPGCKPYAEAI-AAGDKINKCPPG
RNFB_HAEIN/40-73 ILPQSQCGQCGYPGCKPYAEAI-CNGDEITKCIPG
Q9WY91_THEMA/45-79 VLPGINCGACGFAGCEAYAKAIVKGQAETNRCLPG
O27707_METTH/14-48 LLPGYNCGICGYARCDEYAAALLKGRAEIDRCHFM