EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04056 alignment
(6 sequences with 264 aa)


TF2H2_CAEEL/7-259 KGYTWEAGYAEGLNINDVLVEDEGGSIEKSIAKYVADSKRKARLTKRP-----ERIRLGIMRHVMIVIDCSRFMTSKAMPPSRFVVVMKALQTFLDRFFEQNPIAQIGLITCKDRKADRLTMMTGNIRVLKESLNTLTEAFCGGDFSLQNALQLACANLKGMPGHVSREVVLVISALSTIDPGNIYSTIETMKRMNIRCSAIGLSAEMFVCKEMAKATK-G---EYSVALDPDHLQLLFSKHTLPPSSAKSS--ECNAIHVGFP
TF2H2_MOUSE/7-255 RTKRWEGGY---ERTWEILKEDETGSLKATIEDILFKAKRKRVFEHH------GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETG-G---TYHVILDETHYKELLAHHVSPPPASSSS--ECSLIRMGFP
Q9VNP8_DROME/10-258 KEYRWETGY---EKTWEAIKDDEDGMLDGAIAEIIQKAKRQRQAQKS------KQNRLGMMRHMFVVLDCSESMSVPDLKPTRLRCTVKLLELFIEEFFDQNPISQLGLIALKAKRAEKVTELTGTSRVHLKALESLANVSLTSEPSLQNGLDLALKSLKVVPSHASREIVIIMGSLTTCDPVDINLTIDELKKEGIRCSVISLSAEIHVARYLTQQTM-G---TFGAVLDDAHFRDQLMSQVDPPPAAKTQ--HNSLIRMGFP
SSL1_YEAST/72-325 GGYAWEDEI---KRSWDLVKVDDEGDMASLVASIVEARKKRTAKKNI------TPYQRGIIRSLILTLDCSEAMLEKDLRPNRHAMIIQYAIDFVHEFFDQNPISQMGIIIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNPSLQNALEMARGLLLPVPAHCTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKVLGLSAQVAICKELCKATNYGDESFYKILLDETHLKELFNEAVTPLPVNKIN-KGFTLVKMGFP
TFH47_SCHPO/35-287 EGYTWEGEY---QRSWDIVQEDAEGSLVGVIAGLIQSGKRKRLLRDT------TPLQRGIIRHMVLVLDLSNSMEERDFHHKRFDLQIKYASEFVLEFFEQNPISQLSIIGVMDGIAHRITDLHGNPQSHIQKLKSLR--DCSGNFSLQNALEMARASLSHIASHGTREVLIIFGSILSSDPGDIFKTIDALVHDSIRVRIVGLAAEVAICKEICNKTNSSTKNAYGVVISEQHFRELLLESTIPPATDSAKTTDASLVMMGFP
Q9ZVN9_ARATH/22-277 GIGEWERAYVD-DRSWEELQEDESGLLRPIDNSAIYHAQYRRRLRMLSAAAAGTRIQKGLIRYLYIVIDFSRAAAEMDFRPSRMAIMAKHVEAFIREFFDQNPLSQIGLVSIKNGVAHTLTDLGGSPETHIKALMGKL--EALGDSSLQNALELVHEHLNQVPSYGHREVLILYSALCTCDPGDIMETIQKCKKSKLRCSVIGLSAEMFICKHLCQETG-G---LYSVAVDEVHLKDLLLEHAPPPPAIAEF-AIANLIKMGFP