EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04054 alignment
(6 sequences with 415 aa)


Q20937_CAEEL/2092-2481 SLFNEIT---GPDPLKLLEPI----AWSILEAFGQTF----FALQPRRM-PGFAFAWLDIVGHRNVIGRLLANTGIAETVDAVKTAATYTQLIISHLKFLAPFLRNIQLPKSIAILYKGTLRVLLVILHDFPELLCEFHYVICDTIPPNCVQLRNLILSAYPRQMRLPDPFALNFKQVDTIPEMAVEPKSNLNM-ATIIPDNIRIPLDEYLANRIS-VDFLPNLPTLLQTQNQ--A-----GTKYNTTVMNALVLYVGIRAIEHLHLRRQRISTLNIAHTSYMDIFQNLAIQLDTEGRYLLFNGIANQLRYPNAHTHYFSCVFLYLFKNSTND----TIQEQITRILFERLVALRPHPWGLLITFIELIKNPTYNFWRYEFTSCAPEIQRLFQNVANTCVPAQGSQPQAQPDGAP
O81909_ARATH/1466-1860 IQQRELSVAHCISSEDINSGAVQSPQQPQSPSFLIIDMFSQLLPTPSTHCSLLRFLLSELVSHRSFMPKLLT-------VNGQKGWPYVQRLLVDLLQFLEPFLRNAELGGPVHFLYKGTLRVLLVLLHDFPEFLCDYHFTFCDVIPSSCIQMRNIILSSFPRNMRLPDPSTPNLK-IDLLPEIVEAPCILSEVDAALKAKQMKNDVDEYLTSRQQNSTFLSELKTKLLLSSS--E-ASSAGTRYSVPLINSLVLYTGMQAIQQLQA-----GETQAQNVVALQMFKYLSMELDTEGRYLFLNAIANQLRYPNNHTHYFSFIMLYLFFESDQE----IIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPRYSFWKQAFIRCAPEIEKLFESVARSCGGLKPVDEGMVSGGWV
Q9BVZ6_HUMAN/159-539 MLLLELN-----APEHVLETI----NFQTLTAFCNTF----HILRPTKA-PGFVYAWLELISHRIFIARMLAH------TPQQKGWPMYAQLLIDLFKYLAPFLRNVELTKPMQILYKGTLRVLLVLLHDFPEFLCDYHYGFCDVIPPNCIQLRNLILSAFPRNMRLPDPFTPNLK-VDMLSEINIAPRILTNF-TGVMPPQFKKDLDSYLKTRSP-VTFLSDLRSNLQVSNE--P-----GNRYNLQLINALVLYVGTQAIAHIHNKGSTPSMSTITHSAHMDIFQNLAVDLDTEGRYLFLNAIANQLRYPNSHTHYFSCTMLYLFAEANTE----AIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCMGQKQAQQVMEGTGAS
Q9V591_DROME/1779-2160 MLFMELC-----TADVILESL----MHSIVSAFAYTY----HLLNPSVA-PGFCFAWLELISHRVFLGRILVQ------IPGQKGWPLYAQLLQDLFKYLAPFLRNTELGKPVQLLYKGTLRVLLVLLHDFPEFLCDYHFGFCDTIPPNCVQMRNIILSAFPRNMRLPDPFTPNLK-VDMLSDSSNAPKVLSSYIMNIQPANFKKDLDSYLKARAP-VTFLSELRGHLQVTSE--P-----GTRYNMALMNALVMYVGTQAIALIRNKNFVPNTSNIAHSAHMDIFQNLAVDLDTEGRYLFLNAIANQLRYPNSHTHYFSCAVLHLFAEANSE----AIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPIYKFWDHDFVHCAPEITKLFESVARSCLAKSNVTQQLNMPVVD
P87112_SCHPO/1718-2095 SILSELD-----DAKDVLESC----FVDIYSVILECF----LAIQPRSF-PAFTFAWLSLISHSYLLPKVLL-------VNNDKINDLFSEILMSFLKFLD--LKDDIDKAQFKLLYNGFLRIILVLLHDFPGFLATHCYQLIPYIPLECVQLRNMVLSAFPSDLHLPDPFAQGLK-VGRLPEVTRAPLISNSVSASLEKFASALDLEACFSSSKP-AE-VAKLLLEVYSSQD-------TPTKLNEW-ANYFMLCLIRHATRDSPAKQAPQFQ---SKSPECVIISTMNRSCDSKCRYFLLTAIANQLRYPSSHTYYASCCFLYLFKSSSNNPQELLIKEQMTTVLLERIICNRPHPWGLLITFTELLKNEDYNFWKHPYIKRNDEICRLFDSLHEHVMAPSSANNVSTEEATE
NOT1_YEAST/1698-2098 NILYEWATIRTHNFVRISDSSTRQELIEFDSVFYNTFSGYLHALQPFAF-PGFSFAWVTLLSHRMLLPIMLR-------LPNKIGWEKLMLLIIDLFKFLDQYTSKHAVSDAVSVVYKGTLRVILGISNDMPSFLIENHYELMNNLPPTYFQLKNVILSAIPKNMTVPNPYDVDLN-MEDIPACKELPEVFFDPVIDL--HSLKKPVDNYLRI-PSNSLLRTILSAIYKDTYDIKKGVGYDFLSVDSKLIRAIVLHVGIEA--GIEYKRTSSNAVFNTKSSYYTLLFNLIQNGSIEMKYQIILSIVEQLRYPNIHTYWFSFVLMNMFKSDEWNDQKLEVQEIILRNFLKRIIVNKPHTWGVSVFFTQLINNNDINLLDLPFVQSVPEIKLILQQLVKYSKKYTTSEQDDQSATIN