EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04048 alignment
(6 sequences with 170 aa)


SEC8_YEAST/28-175 MNSSLDHLQNDLNRINLQWNR--------ILSDNTNP-------------LELALAFLDDTSVGLGHRYEEFNQLKSQIGSHLQDVVNEHSQVFNTNVASYGKAVSSIMQAQEQTLNLKNCLKEANEKITTDK-GSLQELNDNNLKYTKMIDVLVNIEELLQIPEKIEEN
SEC8_NEUCR/55-223 RNAPPPRSAQRGRTGAGDMQIQSNAERQIGNVLDLIKREWPAMVETDCIPVQLALQLLDTSSVGRAHEYRNFQQTHQFLQESLKNIVHDHHQGFNSSIGTFHKIQGSIQSSQKKVRALKESLAASKTALCTTN-PELKQLHATSRMYDGVLQTLNELDDLRTVPDQLEAR
SEC8_SCHPO/35-191 DNELSSEYASRGMHIGDLENLVN---EIEDEWKDLGREDYQP----------ISTALELLDDSSFGRDYKSFLNVYDRISAALQTIAHTHKDDFTRGISAYGEIMEGIQKCNSRIIALKQSLEASQECIGNTNSKELQQTLARSSQYKKVISVLKELNEANQLFDNFHTL
SEC8_CAEEL/4-153 NGATPVAAARRHRPLPAERATSNSNE--TGLLINVIR----------------SLTSSVSEDQ-REVEKSRLEKGYKESGALIDRLVKNHQQDVEKCLVSFRDVSSKISNCRERIHNVRNALHTVKSLLELRR-DDLKKLWHENAQQKSVCEIMAKLEELREAPSKIENL
SEC8_DROME/1-146 MDAPPPTKPPRGVKYGKDESAGC------GFLVNVIK----------------SLGFSETTEE-RQKEKQKIEAEFKRSDLRLNELVSRHDQQLTQVLPLFSQVSSEVTASRERIHAVKENLGVCKRLLQCRR-DELRKMWMDAVQHKYVLEMLEQIQELRKVPQRVVGY
SEC8_MOUSE/1-144 MAAEAAGGKYRSTVSKSKDPS--------GLLISVIR----------------TLSTSDDVED-RENEKGRLEEAYEKCDRDLDELIVQHYTELTTAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKR-DELRKLWIEGIEHKHVLNLLDEIENIKQVPQKLEQC