EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04008 alignment
(7 sequences with 158 aa)


Q9Y9J9_AERPE/37-191 VDIEIPEG-ANVIIGRSHF-IKTVEDLYEALVTSCPSLKFGIAFCEASGKRLVRHDGNDEDLRKKAIEACMKIGAGHVFVVYIRNGWPINVLNAIKSVQEVVSIDAATANPVKVVVADLGEQRALLGVADGFKPLGVEGEDDIRERKEFLRKIG.YKR
Q9WY39_THEMA/1-156 MDVSIPEN-ANIILGHSHF-IKTVEDLYEVMVTTNPNLKFGIAFNEASGPCLIRYEGNDEELVNQAIETAKKIGAGHTFVIYIRGGYPINILNQIKNVQEVCRIYTATANPLQVIVGITSQGRAVLGVVDGYSPKGVEGEEDKRKRHAFLREITkYKK
O26795_METTH/14-168 VKIESWED-INLILGQSHF-IKTVEDIYEAIVNTVPQAKFGIAFAEASGDCLVRRAGNDEELEELAAETMLEIAAGHSFIVFLKDAFPINVLQRIKDVPEVVNIYCATANPVEVIIAETDQGRGILGVIDGNSPGEIEGDEDIAARKKFLRVIG.YKF
O69702_MYCTU/8-162 VSVDKPDD-VNVVIGQAHF-IKAVEDLHEAMVGVSPSLRFGLAFCEASGPRLVRHTGNDGDLVELATRTALAIAAGHSFVIFLREGFPINILNPVQAVPEVCTIYCATANPVDVVVAVTPHGRGIVGVVDGQTPLGVETDRDIAQRRDLLRAIG.YKL
Q97BF9_THEVO/6-160 VDMIVPND-SNIIVGYSHF-IKTVEDLNEIVHTSMPKCRYAIAFSEASGDRLIRYEGNDDELVNAAIENIKRISAGHTFVILLRDAYPINILNAVKSCQEVGGIFAATANSLKIIIYKGENGNGVLGVIDGMSPVGVESDDDKKKRRDLLRKIG.YKQ
O59581_PYRHO/7-161 IDIEKPEG-VEVIIGQGNFSIFTVDDLARALLTAVPGIKFGIAMNEAK-PQLTRYTGNDPELEALAAKNAVKIGAGHVFVILMKNAYPINVLNTIKNHPAVAMIYGASENPFQVIVAETELGRAVIGVVDGKAANKIETDEQKKERRELVEKIG.YKI
O30249_ARCFU/6-161 VEILNPDLKYQIVVGQANFSVFTVDDLFRALLTAVPGIKVAVAMNEAA-PKLVRVTGNDEELKKIAAENALRIAASHVFVVVTSNAFPINILNTIKLHPAVCNVFVASANPIEIIVAETELGRAVLGAVDGAAVTRIENEEEKRQRRELCEKLG.YRL