EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03982 alignment
(10 sequences with 316 aa)


Q9V4R4_DROME/42-352 SLIYGGLLVRSLMVTYLAYVFVHHKKTQSVVDGNGWMITRTNLLHRHYRDYFPVEL-VKTAE-LPATKNYILASFPHGILGTGIGINMGLEISKWLELFPQVRPKLGTLD--QHFHVPFMREVLRCWGLVSVSKEALIRMLSKSNDPKHKDNRDGFTSNAVAILVGGAQEAMDSHPGQYILTLKNRKGFVRMAIRTGSSIVPSFSFGEVDIFDQVANPPNSLLRRFQDFVKKLTGVSPLIPVGRGFFN-YTFGFLPFRRRIVQVVGAPIDVVKNEHPDSEYVDKVHGQVIESLEKLFDQYKDKYLENSKSATLVVH
Q9V4R3_DROME/42-352 VLFYGSLLWRTIMVIYLVYVYANHKRTHSIMDGNGWKINRNNWLFRHYRDYFPVQL-VKTAE-LPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLD--QNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISPLIPVGRGIFN-YSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVIDDLEKMFAKYKDQYIPNSKQDKLIIH
Q9XUW0_CAEEL/50-345 FVLFFTGQW-IILGLYAVWYLYDRESPR--RGGYRDNWFRNLSLHKWFAEYFPVKL-HKTAE-LDPNQNYLFGYHPHGILGVGAWSCFGFDACNVKQVFKGIRFNICTLP--GNFTAMFRREILLSIGMIESSKESIEHVLNSEEK-----------GRAVVIVVGGAAEALEAHPGKHTLTLANRKGFVREAVKTGAHLVPVYAFGENDIYKQIDNPEGSKLRKIQEWGKKKMGISLPLIYGRGYFQ-MALGLLPMSRAVNVVVGAPIQVEKELDPSKEVIDEIHGVYMEKLAELFEEHKAKFG-VSKDTRLVFQ
Q9N4S3_CAEEL/44-340 FFLLFTFQW-HILALYACWYFYDMDSPR--RGGYSSDWVRKWRVNDWFAQYFPINL-HKTAE-LSTDKNYLVGIHPHGIISMAAWSNFATNGTGIYEKFPGIRWNLCTLA--LQFRMAIRRELLLLTGLIDCSRESIEYVLDKCGQ----------KGRAVVLVIGGAEEALDAHPGYHTLTLASRKGFVREALITGAYLVPVYSFGENDVFEQMENPVGSRLRNFQEWCKSIFGISYPIFHGRGFFQ-LTFGYLPFRKPIDTVVGAPIPVEKVENPTKEQIDELHTIYCQKLTELFDEHKEKYG-VEKDVPLVLR
O01881_CAEEL/55-349 YMLY-TVLW-PLIFLYGLWMIYDWNSPK--KGAYMSNWFQRQRIHSWYANYFPVKL-HTTSD-MPEEHNYLIGYHPHGIISMAAFINFATNGTGILDTLPRIRFHLCTLV--GQFWTPWRREWGLLHGMIDCSRESIKHVLEHEKK-----------GKAVVLVVGGAEEALDAHPGCHILTLKKRKGFVKIALQTGAQLVPCYSFGENDIFNQAENPKGSTIRQFQTIMKRVLGFSPPAFYGRGVFN-YTFGLLPFRKPINTVLGAPISVTKTVNPTQEQIDTLHQTYMDRLHELFEEHKTKYD-VSPTTQLVIN
Q23067_CAEEL/63-359 HVLFNTRWW-FLVPLYAVWFYYDFDTPK--KASRRWNWARRHVAWKYFASYFPLRL-IKTAD-LPADRNYIIGSHPHGMFSVGGFTAMSTNATGFEDKFPGIKSHIMTLN--GQFYFPFRREFGIMLGGIEVSKESLEYTLTKCGK-----------GRACAIVIGGASEALEAHPNKNTLTLINRRGFCKYALKFGADLVPMYNFGENDLYEQYENPKGSRLREVQEKIKDMFGLCPPLLRGRSLFNQYLIGLLPFRKPVTTVMGRPIRVTQTDEPTVEQIDELHAKYCDALYNLFEEYKHLHS-IPPDTHLIFQ
Q9DCL0_MOUSE/40-335 VMLVLYNYW-FLYIPYLVWFYYDWRTPE--QGGRRWNWVQSWPVWKYFFLYFPICL-VKTQD-LDPGHNYIFGFHPHGIFVPGAFGNFCTKYSDFKKLFPGFTSYLHVAK--IWFCFPLFREYLMSNGPVSVSKESLSHVLSKDGG-----------GNVSIIVLGGAKEALEAHPGTFTLCIRQRKGFVKMALTHGASLVPVFSFGENDLYKQINNPKGSWLRTIQDAMYDSMGVALPLIYARGIFQ-HYFGIMPYRKLIYTVVGRPIPVQQTLNPTSEQIEELHQTYLEELKKLFNEHKGKYG-IPEHETLVFK
Q9DCV3_MOUSE/92-388 MYTFCTDCW-LIAVLYFTWLAFDWNTPK--KGGRRSQWVRNWAVWRYFRDYFPIQL-VKTHN-LLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLA--GNFRMPVLREYLMSGGICPVNRDTIDYLLSKNGS-----------GNAIIIVVGGAAESLSSMPGKNAVTLKNRKGFVKLALRHGADLVPTYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITVPKLEHPTQKDIDLYHAMYMEALVKLFDNHKTKFG-LPETEVLEVN
Q9H630_HUMAN/39-264 IALLFTRFW-LLTVLYAAWWYLDRDKPR--QGGRHIQAIRCWTIWKYMKDYFPISL-VKTAE-LDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMPT--LWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGG-----------GNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHG----------------------------YQASGKSTLGSV-------GNWQGFYFG------------------GKMAETNADSI----------LVEIF-------S--PFTIKIIFW
Q9ASU1_ARATH/39-312 SLIFLPPSL-SLMVLGLLSLFIFIPIDH--RSKYGRKLAR--YICKHACNYFPVSLYVEDYEAFQPNRAYVFGYEPHSVLPIGV-VALC-DLTGFMPI-----PNIKVLASSAIFYTPFLRHIWTWLGLTAASRKNFTSLLDSGYS--------------CVLVPGGVQETFHMQHDAENVFLSRRRGFVRIAMEQGSPLVPVFCFGQARVYKWWKPDCDLYL-----KLSRAIRFTPICFWG--VFGSP----LPCRQPMHVVVGKPIEVTKTLKPTDEEIAKFHGQYVEALRDLFERHKSRVG-----YDLELK