EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03975 alignment
(10 sequences with 130 aa)


Q9X005_THEMA/46-157 MLPDSGG----------KTDKPGKYADTAVKTLVEELKKMGAKVERLEAKIAGGASMFESKGM----NIGARNVEAVKKHLKDFGIKLLAEDTGGNRARSVEYNIETGKLLVRKVGGGE----QLEIKEI
Q9KA57_BACHD/48-162 MLPDSALGK-------KQEFNRAKYADTALDLLLSKLEAIGAKRYSLKAKMAGGAQMFSFASNNDMMRIGQRNVEAVKKKLRELSIPILAEDVGGSNGRTIEFNPETKRLSIRTVHQG--------EKEI
CHED_BACSU/52-166 MLPDSTLSK-------TAELNRAKYADTAVQTTIDMLIEAGCRKFALKAKLAGGSEMFKFKSTNDLMKIGPRNVLAIKEQLSLFNIPIISEDTGGSSGRTIEFEPKSCMLHIRTVKQG--------EKTI
O58226_PYRHO/47-162 LLPEAAR-Y-------GHRGNPAKYVDTGLQLLLKEVIKLGASKFRLEAKLFGGAQMFDNIRS-EELKIGEKNVQVAKRELRKLGIRLVAEDTGGKGGRTIYLDLSTGKVRMRKVTEGK-----VIEKVY
O29224_ARCFU/47-157 MLPQSGN----------GTKRSAKYADHAVEMMTEAMERLGSDRKRIVAKMAGGAQIFKHMTM-DMLRIGDRNAEAIRTILRDYGIRIVSEDLGGDEGRTVYFFTNDGRMLVKYSRGG--------ELWI
Q9HQW9_HALN1/1-109 MLPEADG----------PVDTPAKYVDSGLDEMVSALLRLGASPSTLTAKLAGGSTMLDLSIG---DSVGSRNVSAAERALADADIELLASETGGDSGRSVSFSPSSGDVTIDRVDAE--------VHVI
O51551_BORBU/55-163 VLVKSDL-D-------ISPDQRGRYGIYAIPMLINAMLENGASKSNLKAKLFGGTNFMAKGSV----KVGLENSEFAVNTLNKYRIPILAKDFDQSKSRKIFAFPENFKVIVEYPDGT---------KVF
O87719_CAUCR/58-168 LLPDSGD-G-------RRDGDAVRYGAYAMEVLINDLLKRGARRERLEAKIFGGAKLFDGLSD-----VGASNAAFAERFLRDEGIPIVSSSTGGVSARRVEFWPASGRVRQRLVAVDN------APQDV
Q9KKL4_VIBCH/92-216 LLPFNNQFESQHWHPQALLSDSSRYGCYAMEVLINRLLSMGAERERLKFKLFGGAHLMGYQSL-----VGEKNVEFVLEYAKREKLNVVAQDLGGAQPRKLLFDPQTGQAWVKRIGFSSAHAIKQDEELY
Q9I6V8_PSEAE/66-184 MLPERGLGG-------DPASPSARYGSHAMELLINRMLALGASRERLQAKVFGGGSVLRQISA----AIGQRNVEFTLDYLATERIPLLASDVLEAFPRKIYFFPRNGRVLVKSLVELKNDTVLQRERDY