EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03974 alignment
(2 sequences with 160 aa)


ECOT_PSEAE/1-154 MKALLIAAGVAALSSTAMAAK-----LDEKVPYPKADAGFTRQVIHLPKQDAEDAFKVEIIAGKTLEADCNQQRLGGELEEHTLEGWGYSYYRLDKVSGPMSTMMACPGQKKEQRFIPV-VGEGFLLCYNSKLPIVVYAPKDVEVRYRIWSASEKVEKAV
ECOT_ECOLI/1-160 MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAV