EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03971 alignment
(6 sequences with 736 aa)


Q9PHY3_CAMJE/2-730 QITYTLTDESPALATYSFLPIVKAFLSRAHIGVKTSDISLSGRILATFSEYLKEEQRCEDALELLGELVKRSDANLIKTPNISASIPQLKAAIKELQDKGYMLPNYPDEPKNDEELQIKTKYQKVLGSAVNPVLRQGNSDRRSTKAVKDYAKNNPYRVVEFNPNSKTRVSYMKEGDFFSNEKAVLIDQDCVANIEFTSVDGKKEILKEGLKLEKNEILDATFMDVQKLQEFYAKEIKASKDDDVLFSLHLKATMMKVSDPILFGYAVKVFFKELFIEFQDEFEKLGINPNNGLSELLSKIE--NSSKKDEILKKYSEILAKSADISMVNSDKGITNLHVPSDVIVDASMPAMLKNGARLWDKEGKEKDTNAVIPDQTYATIYEAVIEDLHKNGTLNPSKLGSVSNVGLMAKKAQEYGSHDKTFVAKEEGTFKIV.-SNGKVLLEHKVRKGDIYRANQAKFDAVLNWIDLGIERSELSGAEAIFWLDSKRASNKIMITLVQNRLKE---KGKNVAILTPKEACLRSLELIREGKDVISITGNVLRDYLTDLFPILELGTSAKMLSVVPMLNGGAMFETGAGGSAPKQVEQLVEENHLRWDSLGEFLALQASLEFYANKCGNHKAKVLAECLDEAIGEWLENNKAPSRKVKEDDNRTSHFYLAMYFANHLARQASDMELQSFFKDIALELSSNEEKIRAEFNDAQGVKVDLGGYYKFDDEKANKIMRPSATFNAILEK
Q9PA20_XYLFA/23-757 KLIYTLTDEAPFLATQSLLPIIKAYTKVAGIQVETRDISLAGRILAKFPDVLTETQRVSDDLAELGEMTASPDANIIKLPNISASMPQLKAAIKELQEQGYLLPDYPDEPKNSAQKDVKIRYDRVKGSAVNPVLREGNSDRRAPLSVKNYVRKYPHRMGAWSTTSKSHVAHMEGGDFFGSERSAVLAQAGMLKVELIAKDGTVTVLKDKVAVSAGDIVDAAVLSKQALAVFVAAQMSDAKSQGVLFSVHLKATMMKVSDPVIFGVFVSEFYKEALTKHADTLKQVGFDPNNGIGDLYARIVALPEEMQAVIRADVQAQYAKCPGLAMVNSDKGITNLHVPSDVIVDASMPAMIRSSGQMWNVAGTLQDTKAVIPDRCYAGVYKTVIDDCKLHGAFDPVTMGSVPNVGLMAQKAEEYGSHDKTFQVQSGGVVRVS.DDWGEVLFEHSVEVGDLWRMCQTKDAPIQDWVRLAVERARLSHVPAVFWLDSARAHDVQVIAKVERYLKDHDTNGLDIRIMSPVAAMEFSLARIRKGQDTISVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGLFETGAGGSAPKHVQQFTEENYLRWDSLGEFLALAASLEHLGNRYDHVAAKVLAKALDVANGQILDNNKSPAREIGELDNRGSHFYLALYWAQALAAQDEDVALQVKFASLAKVLSEHEVAIVADLNVVQGFPVDIGGYYHPDLARVAAAMQPSKTFNDALRL
Q9JZS1_NEIMB/6-740 TIVYTHTDEAPALATQSLLPIVQAFARHADIDVKTSDISLSGRILAAFPEYLTEAQRVPDALAELGELVKQPDANVIKLPNISASVPQLTAAIKELQSKGFAVPDYPADPQTDEEKAVRERYDRIKGSAVNPVLREGNSDRRAPKAVKNFAKKNPHSMGAWTKDSKTHVATMQSGDFFHNEQSVIVPEATSVSIVFTDKQGNKKELREPVALKAGEIIDATVMSKKALLAFLAEQVKDAKAKGVLFSLHMKATMMKVSDPIIFGHAVKVFFAPVFEKFGDKLAAAGVNVNNGFGNLLANLDKLDADTRTAVEAEIAAVYAANPDLAMVDSDKGITNLHVPSDVIVDASMPAMIRNSGRMWDKNGKAQDTKAVIPDSSYAGVYQATIDFCREHGAFDPTTMGTVPNVGLMAQAAEEYGSHNKTFEIEADGQVQVI.DAAGKVLMQHDVEAGDIWRMCQTKDAPVKDWVQLAVNRARLSNTPAVFWLDENRPHDKSLLAKVKAYLAELDTNGLDIRVLAPEEAAKFSLGRLKNGEDTISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGMFETGAGGSAPKHVQQFLEENHLRWDSLGEFLALAVSFEHLAQKTGNAKAQVLADTLDAATEKLLLNDKSPKRKAGELDNRGSHFYLTLYWAQELAAQDKDAELKAAFTPLAAALTADEAKIVAELSAVQGKAADIGGYYAANPEKAAQVMRPSVTFNQALNA
Q9KSW5_VIBCH/7-741 TIIYTITDEAPALATYSLLPIIQSFTASSGINVETRDISLAGRILANFPEHLTEEQRISDALTELGELAKTPEANIIKLPNISASVPQLKAAIKELQDKGYALPNYPEEPSSYEEEAIKATYDKIKGSAVNPVLREGNSDRRAPASVKNYAKKNPHSMGAWSKDSKSHVASMSDKDFFGSEKSMTVSGATKVAIEFVGKEGAVKVLKKPFALQDKEIIDTSVMSKKALIAFFEKEIADAKAQDVLFSLHMKATMMKVSDPVIFGHAVKVYYKAVFDKYGQLFDQLGVDVNNGLGDVYAKIQSLPEAQRAEIEAAIQAVYATQPALAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGQMWGPDGKQKDTKATIPDRCYAGVYQTVIDFCKQHGAFDPTTMGSVPNVGLMAQKAEEYGSHDKTFILDAEGVVRVI.DEAGKVLLEQSVEAGDIFRMCQVKDAPIQDWVKLAVTRARASNTPAVFWLDPARAHDAELIKKVNQYLPNHDTSGLEIKILSPIEATQYSLVRMKAGQDTISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQVQKENHLRWDSLGEFLALAASLEHLSVVTGNRKAQVLADALDKATGKFLDMNKSPSRRVGEIDNRGSHFYLATYWAQALAEQTADADLAAEFAPIAKALEEKEAQIVAELNGAQGKPGDLGGYYAPEFAKVAPLMRPSSTFNAIIDR
O53611_MYCTU/7-742 TIIYTLTDEAPLLATYAFLPIVRAFAEPAGIKIEASDISVAARILAEFPDYLTEEQRVPDNLAELGRLTQLPDTNIIKLPNISASVPQLVAAIKELQDKGYAVPDYPADPKTDQEKAIKERYARCLGSAVNPVLRQGNSDRRAPKAVKEYARKHPHSMGEWSMASRTHVAHMRHGDFYAGEKSMTLDRARNVRMELLAKSGKTIVLKPEVPLDDGDVIDSMFMSKKALCDFYEEQMQDAFETGVMFSLHVKATMMKVSHPIVFGHAVRIFYKDAFAKHQELFDDLGVNVNNGLSDLYSKIESLPASQRDEIIEDLHRCHEHRPELAMVDSARGISNFHSPSDVIVDASMPAMIRAGGKMYGADGKLKDTKAVNPESTFSRIYQEIINFCKTNGQFDPTTMGTVPNVGLMAQQAEEYGSHDKTFEIPEDGVANIVdVATGEVLLTENVEAGDIWRMCIVKDAPIRDWVKLAVTRARISGMPVLFWLDPYRPHENELIKKVKTYLKDHDTEGLDIQIMSQVRSMRYTCERLVRGLDTIAATGNILRDYLTDLFPILELGTSAKMLSVVPLMAGGGMYETGAGGSAPKHVKQLVEENHLRWDSLGEFLALGAGFEDIGIKTGNERAKLLGKTLDAAIGKLLDNDKSPSRKTGELDNRGSQFYLAMYWAQELAAQTDDQQLAEHFASLADVLTKNEDVIVRELTEVQGEPVDIGGYYAPDSDMTTAVMRPSKTFNAALEA
Q9I0L4_PSEAE/6-739 KITYTFTDEAPALATYSLLPIVKAFAASAGIDVETSDISLAGRILANFADRLEADQRIEDDLARLAVLATSPDANIIKLPNISASVPQLKGAIAELQGLGYKVPDFPEDPQTDEEKEVRARYAKILGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSMASRSHADYMRGGDFFSSEQSITMAKAGDVRIEFVGKDGKVEVKK-QLSLQEGEVLDSMFMSCGKLRDFFEKTLQDCKETGVMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKWGQLFEELGVNPNNGISSVYDKIKSLPASQQEEILHDIHEVYSHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNSGQMWGKDGKQKDTKAVMPESTYARIYQEMINFCKTNGAFDPTTMGSVPNVGLMAQKAEEYGSHDKTFEMTADGTMRVV.LADGSVLMQHKVETGDIWRACQTKDAPIRDWVKLAVTRARQSDTPAIFWLDPERAHDRELRKKVELYLKDHDLTGLDISIMGYNEAIRVSMERLIRGKDTISVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLRWDSLGEFLALAVSLEETGIKTGNAKAKLLGKALDEATGKLLDNNKSPSRKVGDIDNRGSHFYLAMYWAQALAAQNEDAELKAHFAPLAKALTEQEATIVAELNAVQGKPAEIGGYYRSNPELTSKVMRPSATFNAAIDS