EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03946 alignment
(13 sequences with 61 aa)


RM11_CAEEL/22-81 LLRTNIKAQMASAAPPLGPQLGQRGLNVANFCKEFNKETGHFKQGVPLPTRITVKPD.RTY
RL11_THETH/7-65 VVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATAN-MGDAIVPVEITIYAD.RSF
RL11_STRGR/11-69 LIKLQINAGAANPAPPVGPALGQHGVNIMEFCKAYNAATES-QRGMVVPVEITVYED.RSF
RL11_ECOLI/7-66 YVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYAD.RSF
RL11_THEMA/7-65 QIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETAD-KAGMILPVVITVYED.KSF
RL11_SYNY3/8-66 LIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNAKTAD-KPGMIIPVEISVFED.RSF
RK11_SPIOL/79-137 VIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTAD-KPGFVIPVEITVFDD.KSF
RL11_BACSU/7-65 VVKLQIPAGKANPAPPVGPALGQAGVNVMGFCKEFNARTAD-QAGLIIPVEISVYED.RSF
RL11_LIBAS/7-66 IVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKD.KSF
RL11_SULAC/4-63 TIKIMVEGGSAKPGPPLGPTLSQLGLNVQEVVKKINDVTAQ-FKGMSVPVTIEIDSStKKY
RL11_HALN1/3-61 TIEVLVAGGQADPGPPLGPELGPTPVDVQAVVQEINDQTEA-FDGTEVPVTIEYEDD.GSF
RL12_YEAST/12-70 YLYLRAVGGEVGASAALAPKIGPLGLSPKKVGEDIAKATKE-FKGIKVTVQLKIQNR.QAA
RL12_HUMAN/12-70 VVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGD-WKGLRITVKLTIQNR.QAQ