EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03939 alignment
(4 sequences with 58 aa)


RL23A_TOBAC/12-66 SDPKAQAAKVAKAVKSGSTLKKKSQKIRTKVTFHRPKTLKKDRNP---KYPRISAPGR
RL25_KLULA/1-54 MAPSTKATAAKKAVVKG-TNGKKALKVRTSASFRLPKTLKLARSP---KYATKAVPHY
R23A1_CAEEL/6-59 PAKTAKALDAKKKVVKG-KRTTHRRQVRTSVHFRRPVTLKTARQA---RFPRKSAPKT
RL23A_TRYBB/13-70 KNSAPKSAVSKKVAKKGAPAAAAKPTKVVKVTKRKAYTRPQFRRPHTYRRPATVKPSS