EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03932 alignment
(7 sequences with 211 aa)


CUTC_XYLFA/26-227 AGLEVAAGSVASALAAQEGGAMRVELCHGLGGGGLTPSYGMLAVVRE---RLHIPLYVLIRPRGGDFVFSEEEMEVMCCDVECCVRLGCDGVVLGALDPAGEVDMGMMRVLIAVAG--SLGVTFHRAIDVSAD--PGRTLEDVIALGCERVLTSGGR--SSALEGAETIAALVAQAAGRVVVMPGAGVSAGNVLELRVRTGAHEFHASARS
CUTC_CAUCR/6-206 VLLEVCVDTPAGLAAAIAGGADRVELCSALALQGLTPAPGLMAQAA----SAPIPVYPMIRPRHGDFCYDARDLDAMRRDIDAVRGYGLPGVTIGASQANGALDLKVLRKLVEQAE--GLGTTLHRAFDVVPD--MSEALEIAVELGFERVLTSGGA--LSALDATDRLAALVEQAGERISIMAGAGVRPGNIAELVRRTGVREAHGSFGG
CUTC_PASMU/1-202 MKIEVCIDNIESVHIAQNAGADRLELCACLSVGGVTPSYSLIKSAVD---FANIPCYVMIRPRAGDFLFSTQEVNMMLDDIHLAKQLGAQGIVIGALTKHADIDLSVCETLIQAAE--GLGVTFHRAFDLCRD--PVTSLEQLIQLGCERVLTSGQK--ASAVEGQPLIKQLVSQASNRIRIMAGAGINAQNAALLVKNTGITELHLSGKG
CUTC_VIBCH/3-206 YQVEVCIDNIESLHNAIAGGATRIELCSSLALGGLTPSAGLMYSAGR---VSPIPAYAMIRPREGDFFYHDDELSIMAQDIRTAHQANLQGVVLGLLNADGTIDVKRSKPLIELAHSLGLGVTFHRAFDHCVN--PEHALEEIIALGCERILTSGLA--RNAYLGIERLAQLVKQSAGRISIMAGAGINAQNVAEIALATGVNELHLSAKT
CUTC_RHILO/14-215 PLIEICVEGIDGLLAAQAAGADRVELCASLVEGGITPSLGTVRAALD---QATVPFHVMVRPRGGDFLYSETEYRSMLADVAALRDLGVPGVVFGCLNADGTIDEKRMGELTEAAG--PLNVTCHRAFDMTRD--PAEALEALIRCKVGRVLTSGQR--DSAIEGLPLLADLVRQAGDRIIILGCGGLDLANIAEVRRKTGLAEMHFAALK
Q9A184_STRPY/1-209 MIKEFCAENLTLLPTLDAGQISRVELCDNLAVGGTTPSYGVIKEACQLLHDKKISVATMIRPRGGDFVYNDLELKAMEEDILKAVEAGSDALVLGLLTTENQLDTDAIEQLLPATQ--GLPLVFHMAFDRIPTDHQHQALDQLIDYGFVRVLTHGSPEATPITDNVEQLKSLVTYANKRIEIMIGGGITAENCQSLSQLTGTAIVHGTKII
Q9CE53_LACLA/2-206 IIRELCLENFTKIPQALQAGVERIELCDNLAVGGTTPSYGVIEEAAKYVAESKTTLAVMIRPRGGNFVYNSHELKIIETDTLKAVEAGAQNIVFGALTPGNEIDTDALETVSIAAQ--GLPITFHMAFDEVTD--QEKAIDQLVEFGVDKILTHGGP--LDQSLNTDKLKSLIDYAKGKINIIIGGGVNAENFENLAQLTGTNYVHGTKII