EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03899 alignment
(5 sequences with 125 aa)


ATPZ_VIBCH/7-128 RQGRELAKRLLLIQFSAVMVAAAVFAVAVN-GDWGLSALVGGGIFVIANAVFAGCAFLFAG-ARALKMVAISFYTGEALKILITIVLFSVAYM-YMQLELVPLKLTYLLALGINICAPVLFINNK
ATPZ_VIBAL/7-128 RPGRELARQLLMIQSGAVIFVAAGMAVAIN-PDWGFSALIGGGIFVVANAVFALCAFMFSG-ARAAKRIAASFYTGEVLKILITVALFYVAYM-YMQVELVPLKLTYLLVLGINICAPVLFINNK
Q9HT13_PSEAE/1-123 MPSRLPAFRLLLVQ-LVVVLVAAISLWISWGPVAGYSGLLGGMIAWLPNCYFAYKAFRFSG-ARAAREIVRSFYAGEAGKLILTAVLFALAFAGVKPLMAPALFGVYLLTLMVSWCAPLLMGKTF
ATPZ_PSEPK/10-132 PFHRWAVFPVLLAQ-FVVLLLATLVLWQWKGSVSGYSGLCGGLIAWLPNVYFAWKAFRFSG-ARAAQAIVKSFYAGEAGKMILTAVLFALTFAGVKPLAPLAVFGVFVLTLLVSWFAPLLMNKRL
Q9RFL9_ECO57/9-130 LVSRNVARKLLLVQ--LLVVIASGLLFSLKDPFWGVSAISGGLAVFLPNVLFMIFAWRHQAHTPAKGRVAWTFAFGEAFKVLAMLVLLVVALA-VLKAVFLPLIVTWVLVLVVQILAPAVINNKG