EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03882 alignment
(2 sequences with 449 aa)


MUKF_VIBCH/1-445 MSEFTQDTVQKPIDELVTWVKQYDFSLNLPTERLAFLLAIAVLSNERFDEELGEGELHDAFAIVTRLFAESGEASAFRANNAINDLVKQRLLSRFTSEMTEGASIYRLTPLAIGITDYYVRHREFSKLKLSIQLSMVADEMAKAVESAQQGGS----VAHWRKNVFGVLKYSVSEIFDRIDLNQRVMDEQQQSVKEQIADLLNKDWRDAINNCEALLSETSATLRELQDTLQAAGDELQTQILDIQECVYGDLELDFIEETLSALQMKLDRITSWGQQSIDLWIGYDRHVHKFIRTAIDMDQNRAFSQRLRQSMNDYFEQPWYLTYADAERLSDLRDETLTLRDEEVTGHVPTEVEYEELQQVNDELAQRIGDMLKVHKEQGAAIDLALVLRDYLASHPRTHHFDLARMVVDQAVRLGYSESDYRAIQPDWTAINDFGAKVQANVIDRY
MUKF_SHIFL/1-440 MSEFSQT-----VPELVAWARKNDFSISLPVDRLSFLLAVATLNGERLDGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGD----EFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMRDEEMALRDEEVTGELPEDLEYEEFNEIREQLAAIIEEQLAVYKTRQVPLDLGLVVREYLSQYPRARHFDVARIVIDQAVRLGVAQADFTGLPAKWQPINDYGAKVQAHVIDKY