EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03873 alignment
(8 sequences with 67 aa)


Q9CK46_PASMU/130-195 VDAPILQTLPFNNVVQQVSYNAPIKDVVTPEQ-LEQKNKRIGAMLQNYEVQRRLYADSLILNQQNTQ
RSEA_HAEIN/130-195 PETPVLQTLPFNNAVQEVSYNAPSKDTLTSDQ-LEKKSRRIGAMLQNYELQRRMHSDALDVSSSQVR
Q52554_PHOPR/154-206 SQLPVLQTIPFGGKAEPVSLTRDSVRTGAHNSAPSEAQ--------------LMEQRRRINAMLQDY
Q9KPA7_VIBCH/142-208 NELPVLQTIPLAGSAEPVSLTRDSVEKHAPDSSMQEQRRRVNALLQDYELQLRLNSENSASHQHPVE
RSEA_ECOLI/131-197 PETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQ
Q9AQD3_PSESY/113-172 AQLAQQTQQP-------ANLTVPQVKGPAVLAGYTESAEQAPGPMANGVLQGGGQGDQRLPGYLRQH
MUCA_PSEAE/113-170 PQMAQQGTTP--------QIALPQVKGPAVLAGYSEEQGAPQV-ITNSSSSDTRWHEQRLPIYLRQH
Q9RCH7_AZOVI/113-171 AELAQRAPQP--------SLSAPQVQGTPILAGYTEGVEQSQEPSSKDMGKDSEWHEKRLPTYLRQH