EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03866 alignment
(2 sequences with 166 aa)


HAPP_PHYPO/1-164 MMKYVFVALCLFAVVALATEVEQKESNTRVARLNVGG--LVGCVVALVANIVGGLLRVIIGLVVTLSGVLQIVVGTVLGLVATVASLALDVVGSTVGGILNSLLGLGAILSLVEEVLHVLLSQALLTGLVNAIFALPLSLLVALSTLTDALASAACDCGASATGAG
HAPS_PHYPO/1-163 MMKYIFIALC-FTAIVLASESDVAKA-SEKGLTVRGGDMLLDCIVAVLAQIVSGLLRVIIGLVITLSGVLEIVIGVVVLLVDVLAALALDLVKGSVTGICSDFLDFDYVTEYIEESLRSS-SAQLLAGLVQALLALPLAVLVALVALTESIARSSCSIGLSECGLL