EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03852 alignment
(7 sequences with 84 aa)


VSR_ECOLI/1-75 ADVHDK---ATRSKNMR.AIATRDTAIEKRLASLLTGQGLAFRVQDASLPG-----RPDFVVDEYRCVIFTHGCFWHHHHCYLF
VSX2_XANOR/2-76 TDRLSP---ERRRYLMQ.QVRSKNTRPEKAVRSLLHSIAYRFRLHRKDLPG-----TPDIVFPSRRLVLFVHGCFWHGHGCRIG
Q9A2E1_CAUCR/2-76 SDVYDK---AKRSAVMA.RVRSQDTGPELRLRRLLTGLGARYRLHRKDLPG-----SPDVVMPGRRLAFFVHGCFWHGHDCARG
VSH2_HAEPA/1-76 MDKLTP---EQRKKCMKaSSKNKGTKPELLLAKYLWALGLRYRKNDRSIFG-----TPDLSFKRYKIAIFIDGEFWHGKDWDIR
VSN1_NEIMC/1-75 MDRLTP---EQRKKCMQ.SNKSKGTKPELALAKAMWALGLRYRKNSGSIFG-----KPDFSFKKYKVAVFVDGEFWHGKDWEQR
VSN1_NOCAE/17-97 SGTYPAPLNAGRSRNMQ.ANRRSGTKPEAALRSALFKLGYRYRKDFLLRLGDGVKVKPDIVFTARKVAVFIDGCFWH--VCPDH
VSR_NEIMA/2-76 TDIFTT---SKRSFVML.KIHSKETKPEVLVRKFLFFQGFRYRKNDKRYVG-----KPDIVLSKYKTVVFIHGCFWYGHSCNKG