EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03851 alignment
(6 sequences with 313 aa)


UVE1_SCHPO/250-527 LGYACLNTILRSMKERVFCSRTCRITTIQRD----------------------------GLESVKQLGTQNVLDLIKLVEWNHNFGIHFMRVSSDLFPFASHA--KYGYTLE-FAQSHLEEVGKLANKYNHRLTMHPGQYTQIASPREVVVDSAIRDLAYHDEILSRMKLNEQLNKDAVLIIHLGGTFEGKKETLDRFRKNYQRLSDSVKARLVLENDDVSWSVQDLLPLCQELNIPLVLDWHHHNIV--PGTLREGSLDLMP--LIPTIRETWTRKGITQKQHYSESADPTAISGMKRRAHSDRVFDFPPCD
UVE1_NEUCR/208-517 LGYACLNTYLRNAKPPIFSSRTCRMASIVDHRHPLQFEDEPEHHLKNKPDKSKEPQDELGHKFVQELGLANARDIVKMLCWNEKYGIRFLRLSSEMFPFASHP--VHGYKLAPFASEVLAEAGRVAAELGHRLTTHPGQFTQLGSPRKEVVESAIRDLEYHDELLSLLKLPEQQNRDAVMIIHMGGQFGDKAATLERFKRNYARLSQSCKNRLVLENDDVGWTVHDLLPVCEELNIPMVLDYHHHNICFDPAHLREGTLDISDPKLQERIANTWKRKGIKQKMHYSEPCDG-AVTPRDRRKHRPRVMTLPPCP
UVSE_DEIRA/11-276 LGLVCLTVGPEVRFRTVTLSRYRALSPAERE------------------------------AKLLDLYSSNIKTLRGAADYCAAHDIRLYRLSSSLFPMLDLAGDDTGAAVLTHLAPQLLEAGHAFTDAGVRLLMHPEQFIVLNSDRPEVRESSVRAMSAHARVMDGLGLARTP--WNLLLLHGG-----KGGRGAELAALIPDLPDPVRLRLGLENDERAYSPAELLPICEATGTPLVFDAHHHVVHD----KLPDQEDPSVREWVLRARATWQPP-EWQVVHLSNGIEG-----PQDRRHSHLIADFPSAY
UVSE_BACHD/5-276 FGYVAMSMELANASPSKTMTATQFEKIEDHEAG---------------------------LRKLERIAKTNLHNCLRLLKHNLAYQISFFRLSSKLVPLVNHP-LTEGWKYELAIAEELQAVGEFASEHQMRIDFHPDHFVVLNSEAKEITRRSLQTLLYHYKLLKGMEIDPR----HRCVLHVGGKKKGVEAGLEQFIENTASIPKSLLSMIMLENDDKSYTIDDVLYLGEKLAIPVVLDIHHHDVL-----HRSKSLQETWQ----RIVATWEDSPLPVKIHLSSPLSGEDDPRHHDYINADRFIAFLHEI
UVSE_BACSU/5-275 FGFVSNAMSLWDASPAKTLTFARYSKLSKTER-------------------------K---EALLTVTKANLRNTMRTLHYIIGHGIPLYRFSSSIVPLATHP--DVMWDFVTPFQKEFREIGELVKTHQLRTSFHPNQFTLFTSPKESVTKNAVTDMAYHYRMLEAMGIADR----SVINIHIGGAYGNKDTATAQFHQNIKQLPQEIKERMTLENDDKTYTTEETLQVCEQEDVPFVFDFHHFYANP----DDHADLNVALP----RMIKTWERIGLQPKVHLSSPKSEQAIRSHADYVDANFLLPLLERF
UVSE_BACCR/5-274 FGYVSHAMALWDCSPAKTMTFTSFKKLSKQER-------------------------E---DKLYHVIRQNLEHTIRILHYNIAHEIPLYRLSSSIVPLATHP--EVEFDYIGVFTPLWRKIGALIKEHNLRISFHPNQFTLFTSDKPHITTNAITDMTYHYKILDAIGIADS----SYINIHVGGAYGNKEKAIERFHENIKKLPTHIKKQMTLENDDKTYTTAETLSICQKENIPFVFDYHHHMAN-----LCEEPLEELLP----AIFETWSHTNISPKVHISSPRSEKEFRAHAEYIDLEFIKPFLHIA