EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03850 alignment
(6 sequences with 293 aa)


Q9LPQ2_ARATH/12-257 DVSLLVLLLDTNPLFWSTTSITFSQFLSHVSVSNESIVLAFLNAVLGLNQLNQVVVIATGYSSCDYIYDS---..----SLTSNHGNFES--NGTGMPAIFGSLLKKLEEFVTKDEELSKEEVSED--RIPSCLLWPGTVCFFLHFFSTC----KILSCLSGLIK----RFCHSFRYVAVMNSIFSAQR---------------LMRTQYSMAANSGLFCFAQKT---------IFATDLHSRGFVQLPKPIGVDFRASCFCHKKTIDMGYICSVCLSIFCEHHK--KCSTCG
TF2H3_HUMAN/7-286 ELNLLVIVVDANPIWWGKQALKESQF---TLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGrlGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHT--ETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKA----AEDSALQYMNFMNVIFAAQKQNILIDACVLDSD--SGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSP--ICTTCE
Q9VPX4_DROME/14-276 CIDLLVIVLDTNP---SQHFVRQNPQ---NLTQILEAVIAFGNAHLMQKAQNKLAVVSCSHHATNFLYPL---..------PRRQVELRQ---VDGQYEAFNLVEKTVKQQLGSILMNAPRLSAPC--ESLLAGSMSMALCYISRLQRNLAPGVKMHSRILVVTG----SNECASQYMTFMNVFFTAQKLGITIDTCALDKT--LSLLQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYRASCFCHRELIDIGYVCSVCLSVFCKYSP--ICTTCH
O74366_SCHPO/22-283 TPSLLVVILDANP---ASWYSLSKKV---PVSKVLADITVFLNAHLAFHHDNRVAVLASHSDKVEYLYPS---..---IAPEQKVAEVDPT-KEANTYRKFREVDDLVLSGMKRLMSSTDKVSR----KTMISGALSRALAYINQVQNKN----TLRSRILIFSL----TGDVALQYIPTMNCIFCAQKKNIPINVCNIEGG--TLFLEQAADATGGIYLKVDNPKGLLQYLMMSLFPDQNLRKHLNTPNQANVDFRATCFCHKKVLDIGFVCSVCLSIFCEPRV--HCSTCH
Q12004_YEAST/22-309 SPSLLTVIIEIAPKLWTTFDEEGNEKG--SIIKVLEALIVFLNAHLAFNSANKVAVIAAYSQGIKYLYPESTS..ALKASESENKTRSDLKIINSDMYRRFRNVDETLVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLTYVNRISKES-VTTSLKSRLLVLTCGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVESTEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSIIPPGNKCPACD
Q09645_CAEEL/49-325 NMSTLSVLIETSSCSWGMLASAHGDR---TIGIILRAIVSFCNAHLGQSANNQLLVFAYGRNVDNKMIYSS--..--TRCEDRNASFLVVKRLRELLSSDALTNDATIGAPLGPALAHAFCHMKKDS-RVVTADPCDDSLGPQTTSEQSETASEKATNRAVVISI----TPIMGSEHGSLMNLFFSAAKQSICVDVVSMGDDFTGGILQQAADITGGSFLHAKKPQTLLKILMTNMLTDPTHRAVFSKLSHNSVDYRASCACHHQLVSSGWVCSICLSVLCQYTP--ICKVCK