EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03846 alignment
(4 sequences with 119 aa)


SULA_SERMA/3-120 TQSLYQPHFGHGSYTTRNVAKNTDIGKENGLISELVYNERQPAVAQ-LLLPLLLQLGKQSRWLLWLTPQQKLSKQWLQQSGLPVDKMVQLSQISPVNTVEAMEKALQTGNYSVVLGWLP
SULA_ENTAE/2-120 FTSAHANRSPLTSASVRRPSHSVVEHSATGLISEIVYREDQPMMTQLLLLPLLQQLGQQSRWQLWLTPQQKLSKEWVQSSGLPLSKVMQINQMSPCNTLESMIRALRTGNYNVVIGWLT
SULA_ECOLI/2-120 YTSGYAHRSSSFSSAASKIARVSTENTTAGLISEVVYREDQPMMTQLLLLPLLQQLGQQSRWQLWLTPQQKLSREWVQASGLPLTKVMQISQLSPCHTVESMVRALRTGNYSVVIGWLA
SULA_SALTY/2-120 YTSGYANRSSSFPTTTHNAARTATENAAAGLVSEVVYHEDQPMMAQLLLLPLLRQLGQQSRWQLWLTPQQKLSREWVQSSGLPLTKVMQISQLAPRHTLESMIRALRTGNYSVVIGWMT