EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03831 alignment
(14 sequences with 59 aa)


Q9CDH5_LACLA/43-100 IVLDSLGNELETGDDLVIVQDLPVKGMP.KPIKQGTKVKNIRINPEGKNEHFIDSKIPG
Q9I704_PSEAE/45-99 VIKDSVGNVLQDGDTITVIKDLKVKGSS.LVVKVGTKVKNIRL-VDG--DHDIDCKIDG
Q9FB32_9ACTO/47-103 AIRDAVGNVLADGDTVTVVKSLKVKGHP.TGIKAGTKVRNIRL-VEGVAGHDIDCKIDG
Q97PK7_STRPN/44-98 VAIDANGNKLADGDTVTLIKDLKVKGAP.KDLKQGTRVKNIRI-VEG--DHNIDCKIDG
Q99ZD4_STRPY/43-97 VVLDSNGVRLSDGDTITVVKDLKVKGAP.KDLKQGTRVKNIRL-VEG--DHNIDCKIDG
O25540_HELPY/42-96 IVKDCHNNLLQNGDSVILIKDLKVKNSS.LVLKKGTKIKNTKL-VNS--DHNVDCKIEG
PHNA_ECOLI/43-97 IVKDANGNLLADGDSVTIIKDLKVKGSS.SMLKIGTKVKNIRL-VEG--DHNIDCKIDG
Q9CP95_PASMU/43-97 VVKDSNGNLLQDGDSVILIKDLKVKGSS.IVLKKGTKAKNIRL-VDA--DHDVDCKIDG
Q9RF97_HAEDU/44-95 IVKDSNGNLLADGDSVLLIKDLKLKGSS.EVLKKGTKFKGIRL-VDG--DHNVDC---G
PHNA_HAEIN/57-108 IVKDSNGNLLAEGDNVLLIKDLKLKGSS.EVLKKGTKFKNIRL-VNG--DHNVDC---G
Q9JWN4_NEIMA/42-96 QVRDANGAALQNGDTVILIKDLKVKGSS.MVIKQGTKVKGIRL-QEG--DHNISCKIDG
Q9PIU4_CAMJE/1-55 MAKDANGIELNAGDSVSIIKDLKVKGAS.TTLKRGTTIKNIKLTSKE---GEIEARVDK
Q9A438_CAUCR/4-59 ETRDSNGTLLADGDTVTLIKDLKVKGSGgVTLKRGTVVKKIRLTGDP---DEIEANVDK
Q9KM40_VIBCH/124-178 KPRDVNGVELKKGDDVTVIKDLPVKGSS.MVIKQGTAVRGIALTEDP---KHIQGKVNG