EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03822 alignment
(24 sequences with 64 aa)


O24180_ORYSA/310-369 SVTNLNAFEIIS-FSKGFDLSGMFIVK--EWRNEARFTSNKSASTIISKLEDVAKALN-LRVRK
CIPKF_ARATH/300-359 RCINLNAFEIIS-LSTGFDLSGLFEKG--EEKEEMRFTSNREASEITEKLVEIGKDLK-MKVRK
Q9LVL3_ARATH/308-366 EPTNLNAFDLIA-LSAGFDLAGLFGD---DNKRESRFTSQKPASVIISKLEEVAQRLK-LSIRK
Q9LYQ8_ARATH/310-369 RLATLNAFDIIA-LSTGFGLAGLFGDVY--DKRESRFASQKPASEIISKLVEVAKCLK-LKIRK
O82051_SORBI/310-369 SLPNLNAFDIIS-LSTGFDLSNLFEEKY--GRREERFTTRQPAGTVFAKLNELAERLK-LKIKK
Q9LWM4_ORYSA/311-371 KPVSLNAFDIIS-LSKGFDLSGLFENDK-EQKADSRFMTQKPASAIVSKLEQIAET-ESFKVKK
Q9FJ54_ARATH/298-358 KPMSYNAFDLISSLSQGFDLSGLFEK---EERSESKFTTKKDAKEIVSKFEEIATSSERFNLTK
Q9SEG2_MAIZE/384-441 RPASLNAFDIIS-FSRGFNLSGLFEE----KGDEVRFISAEPMSDIITKLEDIAKLK-SFKLRR
O65554_ARATH/311-372 ETETLNAFHIIA-LSEGFDLSPLFEEKKKEEKREMRFATSRPASSVISSLEEAARVGNKFDVR-
Q9XFJ3_MESCR/330-391 EPEMLNAFHIIS-LSQGFDLSPLFEEKHREERQDMRFATTKSASTVVSRLEEVAAKAGKFIVK-
Q9XIW0_ARATH/303-361 SVNSITAFDLIS-LSSGLDLSGLFEAKK---KKERRFTAKVSGVEVEEKAKMIGEKLG-YVVKK
Q9C753_ARATH/327-388 TPVTMNAFELIS-TSQGLNLGSLFEKQMGLVKRKTRFTSKSSANEIVTKIEAAAAPMG-FDVKT
O24342_SORBI/307-367 EPVALNAFELIS-MSAGLNLGNLFDSEQE-FKRETRFTSKCPPKEIVRKIEEAAKPLG-FDVQK
Q9ZVD9_ARATH/308-368 QPAAINAFEIIS-MSRGLNLENLFDPEQE-FKRETRITLRGGANEIIEKIEEAAKPLG-FDVQK
Q9MAM1_ARATH/315-376 KPVSMNAFELIS-SSSEFSLENLFEKQAQLVKKETRFTSQRSASEIMSKMEETAKPLG-FNVRK
Q9STV4_ARATH/303-364 GPLTLNAFDLII-LSQGLNLATLFDRGKDSMKHQTRFISHKPANVVLSSMEVVSQSMG-FKTHI
CPK24_ARATH/306-367 GPLMMNAFEMIT-LSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMG-FKSHT
Q9FKL0_ARATH/292-352 SSNFINAFQIIA-MSSDLDLSGLFEENDD-KRYKTRIGSKNTAQETIKKIEAAATYVS-LSVER
Q9LGV5_ORYSA/309-369 KPTHINAFQLIG-MASALDLSGFFEEE-DASQRKIRFTSTHSPKDLFDKIENVVTEMG-FQVQR
CIPK1_ARATH/314-374 SPTIINAFQLIG-MSSFLDLSGFFEQENV-SERRIRFTSNSSAKDLLEKIETAVTEMG-FSVQK
Q9LEU7_ARATH/308-367 SPKFFNAFEFISSMSSGFDLSSLFESKR---KVQSVFTSRSSATEVMEKIETVTKEMN-MKVKR
Q9SEZ7_ARATH/318-377 SPRSFNAFQFITSMSSGFDLSNLFEIKR---KPKRMFTSKFPAKSVKERLETAAREMD-MRVKH
CIPKB_ARATH/303-364 AVKSLNAFDLIS-YSSGLDLSGLFAGCSNSSGESERFLSEKSPEMLAEEVEGFAREEN-LRMKK
O80902_ARATH/304-364 NGKILNAFDLIS-SASSSNLSGLFGNFVT-PDHCDQFVSDESTAVIMRKVEEVAKQLN-LRIAK